DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and Sec14l3

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:394 Identity:76/394 - (19%)
Similarity:134/394 - (34%) Gaps:115/394 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIRSLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEA--RTDDQFLVAFLRFCRWDVEE 65
            ::..|.|:.||            |:||...     :.|..|.|  ..||.||:.:||...:|:::
  Rat     4 RVGDLSPKQAE------------TLAKFRE-----NVQDVLPALPNPDDYFLLRWLRARNFDLQK 51

  Fly    66 AKKRVLFYYTYKS----------KERELLKGRQVDDKLIELARSG--IFATLPKPIGPGGPRIHY 118
            ::..:..|..::.          :..|::: :.:...|....|.|  ::..:..|:.|.|.....
  Rat    52 SEAMLRKYMEFRKTMDIDHILDWQPPEVIQ-KYMPGGLCGYDRDGCPLWYDIIGPLDPKGLLFSV 115

  Fly   119 TRMGHIEPSKHSVSDIFRFHAFRAEIEINTDD-NWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRM 182
            |:...::........|..      |.::.|:. ...|..:|.|.|...:......:....:::..
  Rat   116 TKQDLLKTKMRDCERILH------ECDLQTERLGRKIETIVMIFDCEGLGLKHFWKPLVEVYQEF 174

  Fly   183 NAFLEHGIPANLVATHIVNASRETQFVLGLVRNVMK--------QKELLHIHSTVASLRKAIGLE 239
            ...||...|..|....||.|::  .|.:|.  |:||        :|.::..:|....|.|.|..|
  Rat   175 FGLLEENYPETLKFMLIVKATK--LFPVGY--NLMKPFLSEDTRRKIVVLGNSWKEGLLKLISPE 235

  Fly   240 YLPVEMGGD----------------NGSLSDAM-------TRYE--TQLLSFSPYFTEDE----- 274
            .||...||.                .|.:..:|       |:||  .|:...|.:..|.|     
  Rat   236 ELPAHFGGTLTDPDGNPKCLTKINYGGEIPKSMYVRDQVKTQYEHSVQISRGSSHQVEYEILFPG 300

  Fly   275 ----------------------RYGVDEKLREASE--KDQERGAPLVTDVPNDGTFR-------M 308
                                  :.|..:|..|.:|  ..|...|.:   ||.||:..       :
  Rat   301 CVLRWQFSSDGADIGFGVFLKTKMGERQKAGEMTEVLTSQRYNAHM---VPEDGSLTCTEAGVYV 362

  Fly   309 INFD 312
            :.||
  Rat   363 LRFD 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 12/42 (29%)
CRAL_TRIO 100..248 CDD:279044 33/158 (21%)
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 15/62 (24%)
SEC14 76..245 CDD:214706 37/179 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.