DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and RLBP1

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:271 Identity:52/271 - (19%)
Similarity:99/271 - (36%) Gaps:39/271 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYY 74
            ||.|:.:.|........||..|.::           ..|..|.:.|:|..:::|..|.:.:..|.
Human    74 ELQEMVQAQAASGEELAVAVAERVQ-----------EKDSGFFLRFIRARKFNVGRAYELLRGYV 127

  Fly    75 TYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMGHI------EPSKHSVSD 133
            .::.:..||.     |....|..|..|.|..|   |....|..|.|:..:      :..:.:..:
Human   128 NFRLQYPELF-----DSLSPEAVRCTIEAGYP---GVLSSRDKYGRVVMLFNIENWQSQEITFDE 184

  Fly   134 IFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATH 198
            |.:.:.|..| ::..::...|.|...|.:|................::|...|:...||...|.|
Human   185 ILQAYCFILE-KLLENEETQINGFCIIENFKGFTMQQAASLRTSDLRKMVDMLQDSFPARFKAIH 248

  Fly   199 IVNASRETQFVLGLVRNVMKQK--ELLHIH-STVASLRKAIGLEYLPVEMGGDNGSLSDAMTRYE 260
            .::..........:|:..:|.|  |.:.:| ..::...:.|....||.:.||       .:.:|:
Human   249 FIHQPWYFTTTYNVVKPFLKSKLLERVFVHGDDLSGFYQEIDENILPSDFGG-------TLPKYD 306

  Fly   261 TQLLS---FSP 268
            .:.::   |.|
Human   307 GKAVAEQLFGP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 8/40 (20%)
CRAL_TRIO 100..248 CDD:279044 29/156 (19%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.