DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and sec14l8

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001093463.1 Gene:sec14l8 / 558964 ZFINID:ZDB-GENE-060526-180 Length:395 Species:Danio rerio


Alignment Length:248 Identity:51/248 - (20%)
Similarity:95/248 - (38%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 TVAKIEALRTWIDK-QIYLE--ARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKERELLKGR 87
            :|.:.|||..:.:| |..|.  ....|.||:.:||...:::::::..:       .|..|..|..
Zfish     9 SVKQAEALAQFREKVQDVLPQCPSQSDHFLLRWLRARNFNLQKSEAML-------RKHIEFRKHM 66

  Fly    88 QVDDKLIELARSGIFATLPKPIGPG-------GPRIHYTRMGHIEPS--KHSVS--DIFRFHAFR 141
            :||....|..   :...:.|.:..|       |..:.|..:|.::|.  .||.|  |:.:.....
Zfish    67 KVDTITTEWQ---VPEVIDKYLSGGMCGHDREGSPVWYDVIGPLDPKGLMHSASKQDLIKSKVRD 128

  Fly   142 AEIEINTDDNW------NIAGVVEIIDFTKIPYSLLLQFDPGM--FKRMNAFLEHGIPANLVATH 198
            .||.....|..      ||..:..:.|...:....|  :.|.:  :..:....|...|..|....
Zfish   129 CEILQKDCDRQSERLGRNIESITMVYDCEGLGMKHL--YKPAIETYGEVLTMFEDNYPEGLKRLF 191

  Fly   199 IVNASRETQFVLGLVRNVMKQ---KELLHIHSTVAS-LRKAIGLEYLPVEMGG 247
            ::.|.:.......||::.:.:   ::::.:.|.... |:|.|..|.||...||
Zfish   192 VIKAPKLFPVAYNLVKHFLSEDTRRKVIVLGSNWQEVLQKYIDPEELPAYYGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 11/43 (26%)
CRAL_TRIO 100..248 CDD:279044 33/171 (19%)
sec14l8NP_001093463.1 CRAL_TRIO_N 13..59 CDD:215024 11/52 (21%)
SEC14 78..246 CDD:214706 33/169 (20%)
GOLD_2 304..382 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.