DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and sec14l5

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:XP_031749906.1 Gene:sec14l5 / 493292 XenbaseID:XB-GENE-953433 Length:793 Species:Xenopus tropicalis


Alignment Length:289 Identity:49/289 - (16%)
Similarity:97/289 - (33%) Gaps:96/289 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVDDKLIELA 97
            ||.|: ::.:......|:.::.|||...:::::|::.:....|::       |...||       
 Frog   262 LRQWL-QETHKGKIPKDEHILRFLRARDFNIDKAREILCQSLTWR-------KQHHVD------- 311

  Fly    98 RSGIFATLPKP------IGPG-------GPRIHYTRMGHIEPSKHSVSDIFRFHAFRAEIEIN-- 147
              .:.:|...|      ...|       |..::..|:|.:: :|..|..:......|..:.||  
 Frog   312 --YLLSTWDPPQVLHDYYAGGWHHHDRDGRPLYVLRLGQMD-TKGLVRALGEESLLRHVLSINEE 373

  Fly   148 ----TDDNWNIAG---------------------------VVEIIDFTKIPY-----SLLLQFDP 176
                .::|.||.|                           ::.||:..:..|     .||:...|
 Frog   374 GLRRCEENTNIFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAP 438

  Fly   177 GMFKRMNAFLEHGIPANLVATHIVNASRETQFVLGLVRNVMKQKELLHIHSTVASLRKAIGLEYL 241
            .:|..:...:...|..|.....::.|..:.|...||:..:.|                    |.:
 Frog   439 RVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGPGGLIDYIDK--------------------EVI 483

  Fly   242 PVEMGG-------DNGSLSDAMTRYETQL 263
            |..:||       :.|.:..|:.|...:|
 Frog   484 PDFLGGECMCEVSEGGMVPKALYRTPEEL 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 8/35 (23%)
CRAL_TRIO 100..248 CDD:279044 33/205 (16%)
sec14l5XP_031749906.1 PRELI 17..173 CDD:398400
CRAL_TRIO_N 256..301 CDD:215024 8/39 (21%)
CRAL_TRIO 326..490 CDD:395525 30/184 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.