DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and CG10301

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_651173.2 Gene:CG10301 / 42797 FlyBaseID:FBgn0039106 Length:306 Species:Drosophila melanogaster


Alignment Length:316 Identity:97/316 - (30%)
Similarity:164/316 - (51%) Gaps:20/316 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RSLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKR 69
            |.|.|.||::|..::.|.|......|..||.||.:|.:|.||||..||:||||.||:.:||.|:|
  Fly     3 RPLSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFLIAFLRRCRYSLEETKRR 67

  Fly    70 VLFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMGHIEPSKHSVSDI 134
            :..|:|:.:...|::..|.|..:|:::.|.|:......|.|.....:...|.||.:|:.:.:.:|
  Fly    68 IDRYFTHYNLFPEIMNNRCVTQRLLDINRMGVCLYPDMPKGDSRSAMFIARFGHFDPNLYMLREI 132

  Fly   135 FRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATHI 199
            :.|.:...|:....:|..::||:.||||...:....:.:||..:|::...:|.:..|..:...:|
  Fly   133 YHFSSMAMEVIALENDYASLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMYI 197

  Fly   200 VNASRETQFVLGLVRNVMKQKELLHIHSTVASLRKA------IGLEYLPVEMGGDNGSLSDAMTR 258
            :|..::.|..:..:.||:.    :.::..:..|:.:      ||.|.||.|.||.||.|.:.:..
  Fly   198 INMPKDIQGTVMFLYNVLS----MQVNYPIRVLKNSEELIEHIGKESLPEEYGGTNGHLGECVAY 258

  Fly   259 YETQLLSFSPYFTEDERYGVDEKLR--EASEKDQERGAPLVTDVPNDGTFRMINFD 312
            .|..|.|:..||.:|..||..|:||  |.:..:.|.||        :|:||.:|:|
  Fly   259 MEDLLNSYRGYFEQDCNYGTIEELRHGEIATYEAEFGA--------NGSFRRLNWD 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 22/40 (55%)
CRAL_TRIO 100..248 CDD:279044 35/153 (23%)
CG10301NP_651173.2 CRAL_TRIO_N 25..71 CDD:215024 23/45 (51%)
CRAL_TRIO 114..248 CDD:279044 32/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.