DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and CG33523

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:156 Identity:31/156 - (19%)
Similarity:45/156 - (28%) Gaps:66/156 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LEPELAEVARTQLCEDPSSTVAKIEALRTW-----------------IDKQIYLEARTDDQFLVA 54
            |.|:..|:.:....:|.:..:.|...|..|                 |.|.:...|..||||   
  Fly   202 LPPKAVEILKMISKKDINQYINKDNCLAIWGGEDNYEFSFVPEAKKVISKPVAANAGDDDQF--- 263

  Fly    55 FLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYT 119
                       |.|:|.|                ||...:.|..:.|            .::|..
  Fly   264 -----------ADKKVTF----------------VDSAPMVLKETNI------------NKMHTP 289

  Fly   120 RMG--HIEPSKHSVSDIFRFHAFRAE 143
            ..|  ||.|     .|...|::..||
  Fly   290 SEGMLHINP-----KDFVNFNSKNAE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 11/57 (19%)
CRAL_TRIO 100..248 CDD:279044 10/46 (22%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 7/31 (23%)
Motile_Sperm 293..396 CDD:279029 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.