DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and Clvs1

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001102439.1 Gene:Clvs1 / 366311 RGDID:1564200 Length:354 Species:Rattus norvegicus


Alignment Length:330 Identity:80/330 - (24%)
Similarity:136/330 - (41%) Gaps:51/330 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKIRSLE----PELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLE-ARTDDQFLVAFLRFCR 60
            :||:..|:    |:..|.||.:|.|:|......|:.:|..|..:..:. .||||.|::.|||..:
  Rat    20 LAKMTHLQAGLSPDTIEKARLELNENPDVLHQDIQQVRDMIITRPDIGFLRTDDAFILRFLRARK 84

  Fly    61 WDVEEAKKRVLFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPG--GPRIHYTR--- 120
            :...:|.:.:..|:.|:....::.|..:.||..|:.|....|        ||  ..|.||.|   
  Rat    85 FHQADAFRLLAQYFQYRQLNLDMFKNFKADDPGIKRALIDGF--------PGVLENRDHYGRKIL 141

  Fly   121 ---MGHIEPSKHSVSDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRM 182
               ..:.:.|::|.:||.|......|:.|. |....|.|.:.|||::...:....:..|.:.|..
  Rat   142 LLFAANWDQSRNSFTDILRAILLSLEVLIE-DPELQINGFILIIDWSNFSFKQASKLTPSILKLA 205

  Fly   183 NAFLEHGIPANLVATHIVNASRETQFVLGLVRNVMKQK--ELLHIH-STVASLRKAIGLEYLPVE 244
            ...|:...||.....|.||.......:..|::..:|.|  :.:.:| :.:.||.:.|..|:||.|
  Rat   206 IEGLQDSFPARFGGVHFVNQPWYIHALYTLIKPFLKDKTRKRIFLHGNNLNSLHQLIHPEFLPSE 270

  Fly   245 MGG-----DNGSLSDAMTRYETQLLSFSPYFTEDERY------------GVDEKLREASEKDQER 292
            .||     |.|:.:..:         ..|.::::..|            ......||.|.|..:|
  Rat   271 FGGTLPPYDMGTWARTL---------LGPDYSDENDYTHTSYNAMYVKHTCSNLERECSPKPMKR 326

  Fly   293 GAPLV 297
            ...:|
  Rat   327 SQSVV 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 12/41 (29%)
CRAL_TRIO 100..248 CDD:279044 41/163 (25%)
Clvs1NP_001102439.1 CRAL_TRIO_N 51..97 CDD:215024 12/45 (27%)
CRAL_TRIO 125..274 CDD:395525 40/157 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..354 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339603
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.