DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and retm

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001260132.1 Gene:retm / 33899 FlyBaseID:FBgn0031814 Length:707 Species:Drosophila melanogaster


Alignment Length:201 Identity:40/201 - (19%)
Similarity:74/201 - (36%) Gaps:41/201 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 AKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVDDK 92
            :|:..||..:|....||.....|.::.||....|.|.:|...:.....::.:.|       :|..
  Fly   223 SKLLELRKMLDGVDDLERVPSYQTILRFLAARDWHVSQAYAMLCDSLRWRREHR-------IDAL 280

  Fly    93 LIELARSGI----FATLPKPIGPGG---------PRIHYTRMGHIEPSKHSVSDIFRFHAFRAEI 144
            |.|.::..:    |        |||         | ::..|:||:: .|..:..:......|..:
  Fly   281 LAEYSKPAVVVEHF--------PGGWHHLDKDGRP-VYILRLGHMD-VKGLLKSLGMDGLLRLAL 335

  Fly   145 EINTDDNWNIAGVVEIIDFTKIPYSLLLQFD---------PGMFKRMNAF--LEHGIPANLVATH 198
            .|..:....|....|.::...:.:|||:..:         ||:...:|..  :|...|..:....
  Fly   336 HICEEGIQKINESAERLEKPVLNWSLLVDLEGLSMRHLWRPGIKALLNIIETVERNYPETMGRVL 400

  Fly   199 IVNASR 204
            :|.|.|
  Fly   401 VVRAPR 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 12/40 (30%)
CRAL_TRIO 100..248 CDD:279044 24/129 (19%)
retmNP_001260132.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 222..268 CDD:215024 12/44 (27%)
CRAL_TRIO 293..456 CDD:279044 24/124 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.