DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and CG33514

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster


Alignment Length:316 Identity:111/316 - (35%)
Similarity:167/316 - (52%) Gaps:14/316 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIRSLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAK 67
            :||.|.|||.:||:.||.|||....|.::|.:|||::|.:|..|.||||||||||.|::.:|.||
  Fly     4 QIRPLTPELQKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLERAK 68

  Fly    68 KRVLFYYTYKSKERELLK-GRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMGHIEPSKHSV 131
            .::..|||.|:|..:..: ....|.|..|:.::|....||.|:...||||...|||.:...|:::
  Fly    69 SKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPVEKYTM 133

  Fly   132 SDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVA 196
            .:..:......||.|..||..|:.|||.|:|......:.|.|..|.|.|:...|.|..:|..|.|
  Fly   134 LECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKA 198

  Fly   197 THIVNASRETQFVLGLVRNVM--KQKELLHIH-STVASLRKAIGLEYLPVEMGGDNGSLSDAMTR 258
            .|.:|.....:.:..:.:.:|  |.:..|.:| :.:..|.:.|.|:|||.|.||:||:..|.:..
  Fly   199 QHFINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTEQIPLKYLPEEYGGENGTTQDIVAA 263

  Fly   259 YETQLLSFSPYFTEDERYGVDEKLREASEKDQER--GAPLVTDVPNDGTFRMINFD 312
            .|.:|..::.:|.|:..:|.||.||.....|.|.  |.        :|:||.:|.|
  Fly   264 MEKKLDEYADFFQENVNFGTDESLRPGKPIDFEGLFGV--------EGSFRKLNVD 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 22/40 (55%)
CRAL_TRIO 100..248 CDD:279044 47/150 (31%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 22/45 (49%)
SEC14 97..253 CDD:238099 48/155 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
76.850

Return to query results.
Submit another query.