DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and CG31826

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:280 Identity:65/280 - (23%)
Similarity:107/280 - (38%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKE- 80
            |...:..:..:.|||.||..::|...|...|:|..|..||.:.|||..:|.:.:..||.:|.:. 
  Fly     5 TARVDHTAEQIFKIEQLRQLVEKCEDLRVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYEFKRRHP 69

  Fly    81 -----------RELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRMGHIEPSKHSVSD- 133
                       |:|..|......:.:..|||....:.|.:........|.:      |...:.| 
  Fly    70 TWVARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVVFKTVDGFQDYPDYLQ------SLVEMDDL 128

  Fly   134 IFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGI-PANLVAT 197
            ||........::.|        |:..|.|......:.|.||.|...|.:|.  ::|: |.:....
  Fly   129 IFESLLLLPRVQQN--------GITVICDLQGTNRNFLRQFSPAFMKVVNE--KNGVLPFSQRIV 183

  Fly   198 HIVNAS-----RETQFVLGLVRNVMKQKELLHIHSTVASLRKAIGLEYLPVEMGGDNGSLSDAMT 257
            ||:...     ..|.| :..:....|:|...|....::.||:.:|.|.||.|.||...::.|...
  Fly   184 HIIQRGFLMHVTSTLF-MPFMNKEFKEKIFTHDGRHLSKLREMVGYESLPAEYGGPATNVLDTNL 247

  Fly   258 RYETQLLSFSPYFTEDERYG 277
            .: ..|...:.|..:.:.||
  Fly   248 IF-NHLSQNAEYLEKLQTYG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 16/40 (40%)
CRAL_TRIO 100..248 CDD:279044 34/154 (22%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 16/43 (37%)
CRAL_TRIO 92..237 CDD:279044 35/161 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.