DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and CG31636

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001285685.1 Gene:CG31636 / 318865 FlyBaseID:FBgn0051636 Length:313 Species:Drosophila melanogaster


Alignment Length:325 Identity:104/325 - (32%)
Similarity:164/325 - (50%) Gaps:25/325 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKIRSLEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEE 65
            |:.:|.|...|.|:...:|.|.|:.....|||||.|:.||.:|.|.||||||:||||..::.:|.
  Fly     1 MSSVRPLNAALQEICIRELNELPARMAQDIEALRDWVLKQPHLRACTDDQFLLAFLRGTKFSLER 65

  Fly    66 AKKRVLFYYTYKSKERELLKGRQV--DDKLIELARSGIFATLPKPIGPGGPRIHYTRMGHIEPSK 128
            ||::...:||.:....|:...|::  |.:::::.|.|:...:|......|||:...|.|..:.||
  Fly    66 AKEKFDRFYTLQRSIPEVFNERRLATDPQVLDIVRMGVLLQIPMDADDPGPRVTIIRAGSYDTSK 130

  Fly   129 HSVSDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPAN 193
            |...||.|..:...||.:..|||..::|.|||:|...:..|.|....|.:..:.:.:.:..:|..
  Fly   131 HKFQDIIRVGSMFGEIMMFEDDNATVSGYVEIMDMAGVTGSHLFALQPQLLSKFSTYADEAMPTR 195

  Fly   194 LVATHIVN--ASRETQFVLGLVRNVM--KQKELLHIHSTVASLRKAIGLEYLPVEMGGDNGSLSD 254
            ....|.:|  |:.||.|  ..:|:..  |.|..:.:.|..|::.:.:..:|||.|.||..|:|.|
  Fly   196 QKGIHFINVPAAFETGF--NSLRSFFPAKIKSRISVSSDPAAIYELVRRKYLPQEYGGTGGNLQD 258

  Fly   255 AMTRYETQLLSFSPYFTEDERYGVDEKLREASEKDQERGAPLVTDVPND-------GTFRMINFD 312
            .....|.:|.|:.|||.|.:.:|.::||||..  |.:||        |.       |:||.:..|
  Fly   259 ISHTMEAKLSSYGPYFRESQNFGANDKLREFG--DHKRG--------NHRSSFGAVGSFRKLEID 313

  Fly   313  312
              Fly   314  313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 23/40 (58%)
CRAL_TRIO 100..248 CDD:279044 43/151 (28%)
CG31636NP_001285685.1 CRAL_TRIO_N 27..72 CDD:215024 23/44 (52%)
SEC14 96..252 CDD:238099 44/157 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1031056at2759
OrthoFinder 1 1.000 - - FOG0006716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
65.940

Return to query results.
Submit another query.