DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and CG3091

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:269 Identity:62/269 - (23%)
Similarity:120/269 - (44%) Gaps:25/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVDDKL 93
            |:..|..|.:....|..:.:...::.||:...:|||..|......|..::|...|...|.::|::
  Fly    25 KLTDLVAWFEANPNLPEKIEPIVMLRFLKCTAFDVERTKALAELNYCMRNKSPHLFMDRNMEDEM 89

  Fly    94 -IELARSGIFATLPKPIGPGGPRIHYTRMGHIEP-SKHSVSD--IF------RFHAFRAEIEINT 148
             .|..|......|| .:.|.|.::.:.||..::| :::||.:  ||      ||  .:.::|..|
  Fly    90 TAEGLRVSDLLILP-GVTPQGNKLIFFRMADLDPRTRNSVEETKIFVMMSDARF--TKPDVERET 151

  Fly   149 D-------DNWNIA-GVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATHIVNASRE 205
            .       |..:|| |.|:|:|........|......:.:....||:...|:.|.|.|::|....
  Fly   152 GSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLRVYMKFLQEAYPSRLQAMHVINCPTY 216

  Fly   206 TQFVLGLVRNVMKQ--KELLHIHST-VASLRKAIGLEYLPVEMGGDNGSLSDAMTRYETQLLSFS 267
            ...::.::...:::  :.::..|:. :.||.|.:..:.||.|.||..|::::...: ..|.:..:
  Fly   217 LDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLPNEYGGKAGTVAELKAK-GIQSIRDN 280

  Fly   268 PYFTEDERY 276
            ..:..||||
  Fly   281 AAYLSDERY 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 10/39 (26%)
CRAL_TRIO 100..248 CDD:279044 38/167 (23%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 38/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10174
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.