DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and Rlbp1

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:273 Identity:59/273 - (21%)
Similarity:104/273 - (38%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYY 74
            ||.|:.:.|........||..|.          ::|| |..||:.|:|..::||..|.:.:..|.
  Rat    65 ELQELVQAQAASGEELAVAVAER----------VQAR-DSAFLLRFIRARKFDVGRAYELLKGYV 118

  Fly    75 TYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRM--------GHIEPSKHSV 131
            .::.:..||.     |...:|..|..|.|..|   |....|..|.|:        .|.|  :.:.
  Rat   119 NFRLQYPELF-----DSLSMEALRCTIEAGYP---GVLSSRDKYGRVVMLFNIENWHCE--EVTF 173

  Fly   132 SDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVA 196
            .:|.:.:.|..| ::..::...|.|...:.:|............|...|:|...|:...||...|
  Rat   174 DEILQAYCFILE-KLLENEETQINGFCIVENFKGFTMQQAAGLRPSDLKKMVDMLQDSFPARFKA 237

  Fly   197 THIVNASRETQFVLGLVRNVMKQKEL--LHIH-STVASLRKAIGLEYLPVEMGGDNGSLSDAMTR 258
            .|.::..........:|:..:|.|.|  :.:| ..:....:.|....||.:.||       .:.:
  Rat   238 IHFIHQPWYFTTTYNVVKPFLKNKLLQRVFVHGDDLDGFFQEIDENILPADFGG-------TLPK 295

  Fly   259 YETQLLS---FSP 268
            |:.::::   |.|
  Rat   296 YDGKVVAEQLFGP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 12/40 (30%)
CRAL_TRIO 100..248 CDD:279044 32/158 (20%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 17/62 (27%)
CRAL_TRIO 143..292 CDD:279044 31/161 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339627
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.