DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and Sec14l5

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:315 Identity:61/315 - (19%)
Similarity:121/315 - (38%) Gaps:57/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVDDKLIELA 97
            ||.|: ::.:......|:.::.|||...:.:::|:..:....:::       |..|| |.|::..
  Rat   249 LRRWL-QETHKGKIPKDEHILRFLRARDFHLDKARDMLCQSLSWR-------KQHQV-DLLLQTW 304

  Fly    98 RSGIFATLPKPIGP-----------GGPRIHYTRMGHIEPSKHSVSDIFRFHAFRAEIEINTDDN 151
            |.      |.|:..           .|..::..|:|.:: :|..:..:......:..:.:|.:..
  Rat   305 RP------PAPLQEFYAGGWHYQDIDGRPLYILRLGQMD-TKGLMKAVGEEALLQHVLSVNEEGQ 362

  Fly   152 WNIAGVVEIIDFTKIPYSLLLQFD---------PGM--FKRMNAFLEHGIPANLVATHIVNASRE 205
            ....|...........::.||..:         ||:  ..||...:|...|..|....||.|.|.
  Rat   363 KRCEGNTRQFGRPISSWTCLLDLEGLNMRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRV 427

  Fly   206 TQFVLGLVRNVM----KQKELLHIHSTV---ASLRKAIGLEYLPVEMGGDNGSLSDAMTRYETQL 263
            ...:..||...:    ::|.|::..|..   ..|...:..:.:|..:||::     .....|..:
  Rat   428 FPVLWTLVSPFINENTRRKFLIYSGSNYQGPGGLVDYLDKDVIPDFLGGES-----VCNVPEGGM 487

  Fly   264 LSFSPYFTEDERYGVDEKLREASEKDQE----RGAP--LVTDVPNDGTFRMINFD 312
            :..|.|.||:|:...|: ||:.||....    ||:|  :..::|...:....:||
  Rat   488 VPKSLYLTEEEQEQADQ-LRQWSETYHSASVLRGSPHEVAMEIPEGESVITWDFD 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 8/35 (23%)
CRAL_TRIO 100..248 CDD:279044 29/176 (16%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 15/74 (20%)
CRAL_TRIO_N 243..288 CDD:215024 8/39 (21%)
CRAL_TRIO 314..477 CDD:306996 27/163 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.