DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and Clvs2

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_780657.1 Gene:Clvs2 / 215890 MGIID:2443223 Length:327 Species:Mus musculus


Alignment Length:315 Identity:79/315 - (25%)
Similarity:134/315 - (42%) Gaps:42/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LEPELAEVARTQLCEDPSSTVAKIEALRTWIDKQIYLE-ARTDDQFLVAFLRFCRWDVEEAKKRV 70
            |.||..|.||.:|.|:|.:....|:.:|..:..:..:. .||||.|::.|||..::...||.:.:
Mouse     8 LSPETLEKARLELNENPDTLHQDIQEVRDMVITRPDIGFLRTDDAFILRFLRARKFHHFEAFRLL 72

  Fly    71 LFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPGG--PRIHYTR------MGHIEPS 127
            ..|:.|:.:..::.|..:..|..|:.|....|        |||  ...||.|      ..:.:.|
Mouse    73 AQYFEYRQQNLDMFKSFKATDPGIKQALKDGF--------PGGLANLDHYGRKILVLFAANWDQS 129

  Fly   128 KHSVSDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPA 192
            ::::.||.|......|..|. |....:.|.|.|||::...:....:..|.|.:.....|:...||
Mouse   130 RYTLVDILRAILLSLEAMIE-DPELQVNGFVLIIDWSNFTFKQASKLTPNMLRLAIEGLQDSFPA 193

  Fly   193 NLVATHIVNASRETQFVLGLVRNVMKQK--ELLHIH-STVASLRKAIGLEYLPVEMGG-----DN 249
            .....|.||.......:..::|..:|:|  :.:.:| :.:.||.:.|..|.||.|.||     |.
Mouse   194 RFGGIHFVNQPWYIHALYTVIRPFLKEKTRKRIFLHGNNLNSLHQLIHPEILPSEFGGMLPPYDM 258

  Fly   250 GSLSDAMTRYETQLLSFSPYFTEDERYGVD-------EKLREASEKDQERGAPLV 297
            |:.:..:..:|         :.:|..|.||       :..:|.|.|..:|...:|
Mouse   259 GTWARTLLDHE---------YDDDSEYNVDSYNMPVKDVDKELSPKSMKRSQSVV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 12/41 (29%)
CRAL_TRIO 100..248 CDD:279044 40/163 (25%)
Clvs2NP_780657.1 CRAL_TRIO_N 29..75 CDD:215024 12/45 (27%)
SEC14 106..251 CDD:238099 36/145 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 289..327 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835977
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.