DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and C34C12.6

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:291 Identity:63/291 - (21%)
Similarity:92/291 - (31%) Gaps:111/291 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPSSTVAKIEALRT--WID------KQIYLEARTDDQFLVAFLRFCRWDV------EEAKKRVLF 72
            :|.|...|:..:|:  |.|      ::|||   |:...|:..|    |.|      ||..||:..
 Worm   184 NPMSGYMKLWQIRSELWQDWFPEMVQRIYL---TNPPRLLGLL----WKVARVFLSEENLKRIEI 241

  Fly    73 YYTYKSKERELLKGRQVDDKLIELARSGIFA-TLPKPIGPGG-----------------PRIHYT 119
            .     .::..|.|:.:...|:.....|.|. |:|    ||.                 |..||.
 Worm   242 I-----SDKSDLAGKFLPPWLVPKEYGGEFVNTVP----PGDETGVSVRRKITSADYYKPYQHYK 297

  Fly   120 RMGHIEPSKHSVSDIFRFHAFRAEIEINTDDNWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNA 184
            ..| |:..|.|..|:.....|..:|::..       |...:.|||                    
 Worm   298 EHG-IDRPKSSHKDVSPAEKFVFKIQVPN-------GKKLLWDFT-------------------- 334

  Fly   185 FLEHGIPANLVATHIVNASRETQFVL--GLVRNVMKQKELLHIHSTVASLRKAIGLEYLPVEMGG 247
                             ||.|.||.:  |..||.:....|   |.....|.:.           |
 Worm   335 -----------------ASGELQFAIFRGNNRNDLVFPSL---HLITNKLNEE-----------G 368

  Fly   248 DNGSLSDAMTRYETQLLSFSPYFTEDERYGV 278
            ...::||:...:|.|  :.|.|||....|.|
 Worm   369 SLDNVSDSEISFEFQ--NLSGYFTLKLEYTV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 14/54 (26%)
CRAL_TRIO 100..248 CDD:279044 31/167 (19%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.