DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and F18A11.2

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:335 Identity:75/335 - (22%)
Similarity:117/335 - (34%) Gaps:124/335 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VAKIEALRTWIDKQIYLEARTDDQFLVAFLRFC-------RW------DVEEAKK---------R 69
            |.|...||. ||.   ::||.||        :|       ||      :.|||.|         :
 Worm     6 VEKAAILRI-IDS---IDARDDD--------YCAHEFNVYRWLVAYGNEEEEAAKALKRHLNIRK 58

  Fly    70 VLFYYTYKSK----ERELLK---------GRQVDDKLIELARSGIFATLPKPIGPGGPRIHYTRM 121
            .:...:|.||    |.||.|         ..|.|:|:                      :.:.|.
 Worm    59 TIDLNSYSSKTELEEDELNKYVPIDVIGQNHQDDNKV----------------------LMFERT 101

  Fly   122 GHIEPSKHSVSDIFRFHAFRAEIEINTDD------------NWNIAGVVEIIDFTKIPYS-LLLQ 173
            |.|:.|  .:.|....|.| .:|::...:            ....:|.:.|:|...|.:| .|:.
 Worm   102 GKIDIS--GLVDNVLMHKF-MQIKLKMMEGVHQKVVAAERKTGRQSGGLFIMDLDGISFSPKLIS 163

  Fly   174 FDPGMFKRMNAFLEHGIPANLVATHIVNASRETQFVLGLVRNVMKQ----------KELLHIHS- 227
            ...|.::.|...|....|..|....||||   ..||     ||:.|          ||.:.|.| 
 Worm   164 VLTGPYRIMWGTLFDHYPQLLQKIIIVNA---PSFV-----NVLHQACSPFLPEDYKEKIVITSE 220

  Fly   228 -TVASLRKAIGLEYLPVEMGGDNGSLSDAMTRYETQLLSFSPYFTEDERYGVDEKLREASEKDQE 291
             .:.:::|.....:||.::|||         ..:|..|..:|:          .|:.:..||::|
 Worm   221 PAIGAIQKHADKCFLPSDLGGD---------LEKTTSLPMAPF----------PKMNKKYEKEKE 266

  Fly   292 RGAPLVTDVP 301
            :.:.|...||
 Worm   267 KVSLLAISVP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 16/62 (26%)
CRAL_TRIO 100..248 CDD:279044 36/172 (21%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 45/213 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.