DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and Sec14l2

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_446253.2 Gene:Sec14l2 / 116486 RGDID:621779 Length:403 Species:Rattus norvegicus


Alignment Length:224 Identity:44/224 - (19%)
Similarity:88/224 - (39%) Gaps:38/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVDDKLIELARSGIFATLPKPIGPG 112
            ||.||:.:||...:|:::::..:..:..:: |::::       ||:|......:   :.:.:..|
  Rat    34 DDYFLLRWLRARSFDLQKSEAMLRKH
VEFR-KQKDI-------DKIISWQPPEV---IQQYLSGG 87

  Fly   113 -------GPRIHYTRMGHIEPS----KHSVSDIFRFHAFRAEIEIN--TDDNWNIAGVVEIIDFT 164
                   |..:.|..:|.::..    ..|..|:.|......|:.:.  |.....:...:|.|...
  Rat    88 RCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRDCELLLQECTHQTAKLGKKIETITMI 152

  Fly   165 KIPYSLLLQ--FDP-----GMFKRMNAFLEHGIPANLVATHIVNASRETQFVLGLVRNVMKQ--- 219
            .....|.|:  :.|     |.|..|   .|...|..|....:|.|.:.......|::..:.:   
  Rat   153 YDCEGLGLKHLWKPAVEAYGEFLTM---FEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTR 214

  Fly   220 KELLHIHSTVAS-LRKAIGLEYLPVEMGG 247
            |:::.:.:.... |.|.|..:.||||.||
  Rat   215 KKIMVLGANWKEVLLKHISPDQLPVEYGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 7/20 (35%)
CRAL_TRIO 100..248 CDD:279044 33/172 (19%)
Sec14l2NP_446253.2 CRAL_TRIO_N 13..59 CDD:215024 7/24 (29%)
SEC14 76..244 CDD:214706 33/174 (19%)
GOLD_2 300..381 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.