DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1827 and ASRGL1

DIOPT Version :9

Sequence 1:NP_610504.4 Gene:CG1827 / 35989 FlyBaseID:FBgn0033431 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001077395.1 Gene:ASRGL1 / 80150 HGNCID:16448 Length:308 Species:Homo sapiens


Alignment Length:277 Identity:88/277 - (31%)
Similarity:131/277 - (47%) Gaps:41/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 GGLRQTRNAV--VEGCSKCEKLQCDRTVGYGGSPDELGETTLDAMVMDGATMDVGAVAGLRRIKD 143
            |.||:..:||  |||.....:...:...|.|...:..||..:||.:|||..:..|||:.::.|.:
Human    36 GILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIAN 100

  Fly   144 AIKVARHVLEHTQHTMLVGDAASAFANAMG---FESESLVTPESKDMWLQWTAENCQPNFWKNVH 205
            .||:||.|:|.|.|..|....|:.||.|||   ...|.|||..:|..                  
Human   101 PIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKR------------------ 147

  Fly   206 PDPKVSCGPYKPRPTPLTRWKEDRARNEYEIGRKNHDTIGMIAIDVESNIHAGTSTNGARHKIPG 270
                            |.:.|.::...:.:. :||..|:|.:|:|.:.|:...|||.|..:|:.|
Human   148 ----------------LEKEKHEKGAQKTDC-QKNLGTVGAVALDCKGNVAYATSTGGIVNKMVG 195

  Fly   271 RVGDSPIPGAGAYADNEVGAAVATGDGDVMMRFLPSLLAVETMRAGKPPAEAAQEGLRRILKHHK 335
            ||||||..|||.||||::||...||.|:.:::...:.|.:..:..||...|||...| ..:|...
Human   196 RVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSL-GYMKSRV 259

  Fly   336 DFMGALIAVDRLGNYGA 352
            ..:|.||.|.:.|::.|
Human   260 KGLGGLIVVSKTGDWVA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1827NP_610504.4 Glycosylasparaginase 58..366 CDD:271335 88/277 (32%)
ASRGL1NP_001077395.1 PRK10226 1..290 CDD:182319 88/277 (32%)
ASRGL1_like 2..291 CDD:271338 88/277 (32%)
Substrate binding 196..199 2/2 (100%)
Substrate binding 219..222 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.