DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1827 and Tasp1

DIOPT Version :9

Sequence 1:NP_610504.4 Gene:CG1827 / 35989 FlyBaseID:FBgn0033431 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001261920.1 Gene:Tasp1 / 39757 FlyBaseID:FBgn0263602 Length:365 Species:Drosophila melanogaster


Alignment Length:291 Identity:83/291 - (28%)
Similarity:133/291 - (45%) Gaps:61/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RILKQSKGGLRQT---RN--AVVEGC-SKCEKLQ-CDRT-VGYGGSPDELGETTLDAMVMDGATM 130
            |::|::  .||.|   ||  :.|:.| :...:|: |..| .|||.:....|....||.:|||:|:
  Fly    22 RVIKEA--CLRATEILRNGGSAVDACEAAIVRLENCGYTNAGYGSNLCMDGSVQCDAAIMDGSTL 84

  Fly   131 DVGAVAGLRRIKDAIKVARHV---------LEHTQHTMLVGDAASAFANAMG---FESESLVTPE 183
            :.||...:.|:|:.|::||.:         ||.....:|.|..|..:|:.:|   .|...|::.:
  Fly    85 NFGACTNVSRVKNPIQLARRICDAQSSPQLLERIPPMILAGTGAEHYADEVGCSMVEPGVLISSK 149

  Fly   184 SKDMWLQWTAENCQPNFWKNVHPDPKVSCGPYK---------PRPTPLTRWKEDRARNEYEIGRK 239
            :|          .|.|.:|:.: |..|:....|         |.|           .||.|:...
  Fly   150 AK----------FQFNHYKSKY-DLVVNSRLGKATSEESVQVPEP-----------GNEVELAAA 192

  Fly   240 NHDTIGMIAIDVESNIHAGTSTNGARHKIPGRVGDSPIPGAGAYADNEVGAAVA---TGDGDVMM 301
             .||:|.:.:|...|..||.|:.|...|:|||||.:...|||.:|.:....|:|   ||:|:.:|
  Fly   193 -LDTVGAVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCTTGNGEYLM 256

  Fly   302 RFLPSLLAVETMRAGKPPAEAAQEGLRRILK 332
            :   :|||.|... |...::.|...|.:..|
  Fly   257 K---TLLAREICH-GAFSSDCAVTSLHKTFK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1827NP_610504.4 Glycosylasparaginase 58..366 CDD:271335 83/291 (29%)
Tasp1NP_001261920.1 Taspase1_like 3..364 CDD:271336 83/291 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10188
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.