DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL31 and AT4G26230

DIOPT Version :10

Sequence 1:NP_610503.1 Gene:RpL31 / 35988 FlyBaseID:FBgn0285949 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_194353.1 Gene:AT4G26230 / 828729 AraportID:AT4G26230 Length:119 Species:Arabidopsis thaliana


Alignment Length:125 Identity:69/125 - (55%)
Similarity:89/125 - (71%) Gaps:8/125 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVRIDTRL 65
            |::.||.|      .||||||.||:|.:|:|:..|||:||:||||||||||:||||.|||:|.:|
plant     1 MSEKKGRK------EEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAEKEMGTKDVRVDVKL 59

  Fly    66 NKHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTY--VPVSTFKNLQTENVESSD 123
            ||.|||||||..|.|||||:||:||||||:..:.::.||.  :|......|.|:.:|..|
plant    60 NKQIWSKGIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPAEGLSGLGTKIIEEED 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL31NP_610503.1 Ribosomal_L31e 16..97 CDD:460108 58/80 (73%)
AT4G26230NP_194353.1 Ribosomal_L31e 10..91 CDD:460108 58/80 (73%)

Return to query results.
Submit another query.