DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL31 and Rpl31l6

DIOPT Version :10

Sequence 1:NP_610503.1 Gene:RpL31 / 35988 FlyBaseID:FBgn0285949 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_038962515.1 Gene:Rpl31l6 / 366191 RGDID:1561317 Length:173 Species:Rattus norvegicus


Alignment Length:121 Identity:83/121 - (68%)
Similarity:100/121 - (82%) Gaps:1/121 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTKGEKINK-SAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVRIDTRLN 66
            |..|||... ||:||||||||||::.|.:|.:|||||||||:|||.|||.:||||.||.||.|||
  Rat    53 KKGGEKKKDCSAVNEVVTRECTINIHKCIHGVGFKKRAPRALKEIWKFAMKEMGTPDVCIDIRLN 117

  Fly    67 KHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNLQTENVESS 122
            |.||:|.||:.|:.|||||:|:||:||||||||||.|||:||:|||||||.||:.:
  Rat   118 KAIWAKRIRNVPYCIRVRLSRKRNEDEDSPNKLYTLVTYMPVTTFKNLQTVNVDEN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL31NP_610503.1 Ribosomal_L31e 16..97 CDD:460108 56/80 (70%)
Rpl31l6XP_038962515.1 Ribosomal_L31e 67..148 CDD:460108 56/80 (70%)

Return to query results.
Submit another query.