DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL31 and Rpl31l7

DIOPT Version :10

Sequence 1:NP_610503.1 Gene:RpL31 / 35988 FlyBaseID:FBgn0285949 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_038953248.1 Gene:Rpl31l7 / 291561 RGDID:1565894 Length:117 Species:Rattus norvegicus


Alignment Length:113 Identity:79/113 - (69%)
Similarity:96/113 - (84%) Gaps:1/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KTKGE-KINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVRIDTRLN 66
            |..|| |..:|||||:||||.||::.||:|.:|||||||:|:|||||||.:||||.|||||||||
  Rat     5 KKGGEKKKGRSAINEMVTREYTINIHKRIHGVGFKKRAPQALKEIRKFAMKEMGTPDVRIDTRLN 69

  Fly    67 KHIWSKGIRSTPFRIRVRLARRRNDDEDSPNKLYTYVTYVPVSTFKNL 114
            |.:|:||||:.|:.|||.|:|:.|:.|||||||||.||||||:|||||
  Rat    70 KAVWAKGIRNVPYHIRVHLSRKHNEAEDSPNKLYTLVTYVPVTTFKNL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL31NP_610503.1 Ribosomal_L31e 16..97 CDD:460108 54/80 (68%)
Rpl31l7XP_038953248.1 Ribosomal_L31e 19..100 CDD:460108 54/80 (68%)

Return to query results.
Submit another query.