DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urod and CG7560

DIOPT Version :9

Sequence 1:NP_610501.1 Gene:Urod / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_648462.1 Gene:CG7560 / 39276 FlyBaseID:FBgn0036157 Length:349 Species:Drosophila melanogaster


Alignment Length:154 Identity:30/154 - (19%)
Similarity:54/154 - (35%) Gaps:50/154 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QELRKHHDFFTVC------------RTPELACEVTMQPLR-RFDLDASIIFSDILVIPQALGLTV 94
            |.:|:..:..:||            ..|:.:.: .|:.|: :.|..|..|.:.:...|:.:...|
  Fly   163 QSIRQRGETISVCVGGYPEGYTSLGDIPQNSAK-NMEFLKAKIDAGADCIITQLCYRPEVIVQFV 226

  Fly    95 EMHAGVGPVLPQPIVV----------------------PEDL------------KRLTPDGALSR 125
            :.....|  :..||||                      |:||            |.:..|..|.|
  Fly   227 KDCRAAG--ISVPIVVGLMSHESFRSYSMIEQITGVHLPDDLREQLDQLHSAHMKDMKSDQDLIR 289

  Fly   126 LSYVGDAITMMRHKLEGRVPLIGF 149
            ..:|...:..:|:.|:..|.:.||
  Fly   290 RFFVSLTVRTIRNVLDADVGVWGF 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UrodNP_610501.1 hemE 14..354 CDD:273640 30/154 (19%)
CG7560NP_648462.1 MTHFR 76..331 CDD:238299 30/154 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.