DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urod and CG10623

DIOPT Version :9

Sequence 1:NP_610501.1 Gene:Urod / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001286073.1 Gene:CG10623 / 35153 FlyBaseID:FBgn0032727 Length:331 Species:Drosophila melanogaster


Alignment Length:334 Identity:70/334 - (20%)
Similarity:109/334 - (32%) Gaps:114/334 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DAKPFPVLKNDNLLRAARG--EVVDRVPVWVMRQAGRYLPEFQELRKHHDFFTVCRTPELACEVT 65
            |.||..|.......:.|:.  |.||..|:|..|        |.           ...||...:..
  Fly    10 DTKPILVKCGGFSSQLAKNVTEKVDGDPLWGSR--------FD-----------ATNPEAVIQTH 55

  Fly    66 MQPLRRFDLDASIIF-----SDILVIPQALGLTVEMHAGVGPVLPQPIVVPEDLKRLTPDGALSR 125
            :..||.   .|.||.     |.:....:.||:|.|.    |..|.|..|      :|........
  Fly    56 LDFLRN---GADIILTNTYQSSVEGFVKYLGVTRER----GVELIQKSV------QLAKQAKEQY 107

  Fly   126 LSYVGDAITMMRHKLEGRVPLIGFTGAPWTLMGYMIEGGGSKT------MSK--AKAWLNEHPED 182
            ||.:|.       :.|..:|||..:..|:   |..:..|...|      |||  .:||       
  Fly   108 LSEIGS-------EAESALPLIMGSIGPY---GAYLHDGSEYTGNYADKMSKEELRAW------- 155

  Fly   183 SKLFLNLLTDAIVDYLE-------MQVKAGAQM-------------LQVFE----SSAEHLSKEQ 223
            .|..:.:...|.||.|.       |:.:|..::             ||..:    :|.|:.::..
  Fly   156 HKTRIEICLAAGVDGLALETLPCLMEAEAVTELVLDNFPDAKFWVSLQCMDEKHMASGENFAEAA 220

  Fly   224 FLQWCVPYLKRIRDE----------------LVDRLTKKA-IPVVPMTLFAKGAGHSLKEQSELG 271
            ...|.:...::..:.                |:..|||.| ...:|:.:::        .:.|: 
  Fly   221 LSLWRLVQSRKAENRLLGIGLNCVNPLFVTPLLSSLTKVAGSDRIPLVVYS--------NRGEI- 276

  Fly   272 YDVIGLDWT 280
            |||...|||
  Fly   277 YDVEQGDWT 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UrodNP_610501.1 hemE 14..354 CDD:273640 66/323 (20%)
CG10623NP_001286073.1 S-methyl_trans 9..322 CDD:304616 70/334 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462321
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.