DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Urod and CG10621

DIOPT Version :9

Sequence 1:NP_610501.1 Gene:Urod / 35986 FlyBaseID:FBgn0033428 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_001286071.1 Gene:CG10621 / 35152 FlyBaseID:FBgn0032726 Length:331 Species:Drosophila melanogaster


Alignment Length:126 Identity:22/126 - (17%)
Similarity:52/126 - (41%) Gaps:39/126 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 DAIVDYLEMQVKAGAQMLQVFESSAE--HLSKEQFLQWCVPYLKRIRDELVDRLTKKAIPVVPMT 254
            |..::|||:..:   |.:::.:::..  |::||::|..|  |..::.       .::..|::..:
  Fly    68 DGYMEYLELDEE---QSIELIKNTVRLAHIAKERYLTEC--YQAQLS-------VQEGYPLIIAS 120

  Fly   255 LFAKGA-----------------------GHSLKEQS--ELGYDVIGLDWTVDPLEARNLV 290
            :...||                       .|.::.::  |.|.|.:.::.....:||..||
  Fly   121 IGPFGAHLHDGSEYTGSYADFVPAKEITDWHRVRIEACLEAGVDALAIETIPCQMEAEALV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UrodNP_610501.1 hemE 14..354 CDD:273640 22/126 (17%)
CG10621NP_001286071.1 mmuM 5..323 CDD:181899 22/126 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462322
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.