DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and SET5

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_012077.1 Gene:SET5 / 856614 SGDID:S000001250 Length:526 Species:Saccharomyces cerevisiae


Alignment Length:507 Identity:103/507 - (20%)
Similarity:175/507 - (34%) Gaps:195/507 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 AWKL-----KKIASLEEHLDYLGQLQLKESFEQQLEDL---KQKLELLKNQPREQETQGKVVDKS 214
            :|||     :||.: |.||           ::..||.:   |.|:...|....:.:.:.|.:|..
Yeast    70 SWKLSASRFRKILN-EHHL-----------YDTDLETVSLYKDKIHFPKALDSDAKVEVKFIDDE 122

  Fly   215 LGEILTDPGPRGRYMVAKEAISKGNVIFSERASC--FVPLEQLLI------CQQCAATL------ 265
                      .||.:.||...|||.:|..|....  ..||::|.:      |.:|...|      
Yeast   123 ----------HGRGLFAKRDFSKGQIILKENKPIVYIPPLDKLFLISNGKACARCGKALYDLTQH 177

  Fly   266 --MSAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISH--------------L 314
              |...:.|..|  :.::||.||::||:::|:....::|.:.:.:|...:              .
Yeast   178 KIMVHYLDCEVC--KAIWCSEKCKKAHASLHELLYHSWRSNRIDILHAGNWKRFVNYCEKYCFTA 240

  Fly   315 ALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRK-------------------------PEESE 354
            |..:.|.|...:   |......|..|:::.::|::                         .|||:
Yeast   241 AFSVGLIYGSML---LDTTGEVKEQWQKLASISQRERIKLRDASGIGSTFSLLNGTTVHTEEESD 302

  Fly   355 NAPEYLRSLRMVSQLDQAIDEEL----NYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQLII 415
            |..:        ..:::.||:|.    .|.:.|....:  ..|..|| ::|              
Yeast   303 NGTK--------KGVEKNIDDETVWEKCYELFCGAFPK--ASEEIDF-EKF-------------- 342

  Fly   416 SALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAINLP 480
                |...|....|.:                              .||:::             
Yeast   343 ----LTMIGTFNINQY------------------------------NGQVYH------------- 360

  Fly   481 YLSLCNHACEPS--IRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSL---KLQRSHPLKAIY 540
            ::|..||.|||:  |....:...:..:|.|.|.:||:|    .:.|.|.|   :|:| ..|:..:
Yeast   361 WISFINHDCEPNAYIEQVEEHEELRLHARKPIKKGEQI----RITYVNPLHGVRLRR-RELRVNW 420

  Fly   541 KFECTCAKCTRTDPDQNYLS-FHRY-RCEKPNCRQEFLPDA-----KVQQNN 585
            .|.|.|.:|      ||.|| |.|. ..||.|.      ||     |:..|:
Yeast   421 GFLCQCDRC------QNELSTFERVPNLEKKNA------DANLGVEKIDSND 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/47 (28%)
SET <447..526 CDD:214614 16/80 (20%)
SET5NP_012077.1 SET 41..526 CDD:225491 103/507 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I1680
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.