DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and SET6

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_015160.1 Gene:SET6 / 855938 SGDID:S000006086 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:401 Identity:79/401 - (19%)
Similarity:131/401 - (32%) Gaps:135/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 GRYMVAKEAISKGNVIF--SERASCFVPLE-QLLICQQCAATLMS------------APIPCPNC 275
            ||...:...|.||..:.  |......:..| :..:|..|.|...:            ..:.| |.
Yeast    23 GRACFSNGNIPKGTTVLQVSNFTGTSISYEFRKEVCHNCFAYANAKTMKYKLNYDYLRDLVC-NA 86

  Fly   276 HQRV----------VYCSRKCREAH----SAIHKFECAAYRKDILRLLGISHLALRLLLTYIP-- 324
            |.::          .:||..||.::    :.|...||                 ..:||.:.|  
Yeast    87 HYQINPKKFLGAGLWFCSEHCRTSYLQIPNIIELIEC-----------------YEILLHHFPSM 134

  Fly   325 -----YIRPHLQEMTS-------AKGMWEEIMNLSRKPEESENAPEY--LRSLRMVSQLDQAIDE 375
                 |.....:::.|       .:..|:||        ||:..|..  ::|.:.::||....::
Yeast   135 LKRYNYTSEQEEKLNSILISENVIQSSWDEI--------ESKWIPRINNMKSAKRINQLPPTCED 191

  Fly   376 ELNY---HILCANLLQL-YLKEHTDFYDQFHSL-----------PASIEDWQLIISALILRFAGQ 425
            |  |   ..:|.:|..| |:......|..|:.|           |..:...:|:...|.:.....
Yeast   192 E--YCCIRFVCESLFNLKYMDPQCITYRAFNMLQSNELSKISKFPVLLHFQKLVFQTLYILLPSH 254

  Fly   426 L-----------LANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAIN- 478
            |           :.....|:|.               .|||:      |:.     ||...... 
Yeast   255 LHRMLSIPLLRHILGTEYGNAF---------------GLWQE------GEA-----SDSREYFGY 293

  Fly   479 --LPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKL---QRSHPLKA 538
              .|..|..||:|.|:|.....|.|::....:||.:.|:|  |  :||...|.|   :|...|..
Yeast   294 WVFPEASYFNHSCNPNITKYRKGNSMLFTMNRDIKKDEQI--C--IDYSGVLDLPTVKRRAFLAD 354

  Fly   539 IYKFECTCAKC 549
            .:.|:|.|.:|
Yeast   355 SWFFDCACERC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/65 (17%)
SET <447..526 CDD:214614 22/81 (27%)
SET6NP_015160.1 SET <1..370 CDD:225491 79/401 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.