DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and SDG37

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_849969.2 Gene:SDG37 / 816300 AraportID:AT2G17900 Length:485 Species:Arabidopsis thaliana


Alignment Length:485 Identity:103/485 - (21%)
Similarity:174/485 - (35%) Gaps:144/485 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DKSLGEILTDPGPRGRYMVAKEAISKGNVIFSERASCFVP--LEQLLICQQCAATLMSAPIPCPN 274
            |:.||  :::...:||.:........|.||.|::....||  ......|..|..|  :....|..
plant    15 DRCLG--VSNLPQKGRSLFTARDFRPGEVILSQKPYICVPNNTSSESRCDGCFKT--NNLKKCSA 75

  Fly   275 CHQRVVYCSRKCREAHSAIHKFECAAY-------RKDILRLLGISHLALRLLLTYIPYIRPHLQE 332
            | |.|.||...|:::...:|:.||.|.       ||.:...:   .|.:||      ||:.:||.
plant    76 C-QVVWYCGSSCQKSEWKLHRDECKALTRLEKEKRKFVTPTI---RLMVRL------YIKRNLQN 130

  Fly   333 MTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDF 397
                    |:::.::       ....|.....:||.:.:..::::..:...|||:.|.|      
plant   131 --------EKVLPIT-------TTDNYSLVEALVSHMSEIDEKQMLLYAQMANLVNLIL------ 174

  Fly   398 YDQFHSLPASIEDWQLIISALILRFAGQLLANGH-VGDALL---GVGMEPKEFVMLQPELWQKPR 458
              ||.|:.         :..:...|: :...|.| :.|:.|   |:|:                 
plant   175 --QFPSVD---------LREIAENFS-KFSCNAHSICDSELRPQGIGL----------------- 210

  Fly   459 HLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMD 523
                                .|.:|:.||:|.|:....|:....|..|..:|.:..||...|...
plant   211 --------------------FPLVSIINHSCSPNAVLVFEEQMAVVRAMDNISKDSEITISYIET 255

  Fly   524 YRNSLKLQRSHPLKAIYKFECTCAKCTR----TDPDQNYLSFHRYRCEKPNCRQEFLPDAKVQQN 584
            ..::|..|:|  ||..|.|.|.||:|:.    .|.:::.: ...|||....|....|.|.:    
plant   256 AGSTLTRQKS--LKEQYLFHCQCARCSNFGKPHDIEESAI-LEGYRCANEKCTGFLLRDPE---- 313

  Fly   585 NLRWWLRCNAEKPITCTVC------HELQHFAWYNEFLGLIGSSADSS----KRQALFKAFDDLD 639
                      ||...|..|      .|::..|   ..|..:...|.:|    .:||..:.:..::
plant   314 ----------EKGFVCQKCLLLRSKEEVKKLA---SDLKTVSEKAPTSPSAEDKQAAIELYKTIE 365

  Fly   640 KWLVD-HHS------------LKRIMAEEL 656
            |..|. :||            ||.:|..|:
plant   366 KLQVKLYHSFSIPLMRTREKLLKMLMDVEI 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/39 (28%)
SET <447..526 CDD:214614 13/78 (17%)
SDG37NP_849969.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.