DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and smyd3

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001032477.1 Gene:smyd3 / 569507 ZFINID:ZDB-GENE-051120-138 Length:380 Species:Danio rerio


Alignment Length:349 Identity:76/349 - (21%)
Similarity:123/349 - (35%) Gaps:102/349 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RGRYMVAKEAISKGNVIFSERASCFVPLEQLL--ICQQCAATLMSAPIPCPNCHQRVVYCSRKCR 287
            :|..:.|...|..|.||:|.....|......|  .||.|.....|.. .|..| :...||:.:|:
Zfish    14 KGNGLRALREIKPGEVIYSCEPFAFCVARDFLKTACQSCLKRGESLS-RCSQC-KTARYCNVQCQ 76

  Fly   288 EAHSAIHKFECAAYR-------KDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMN 345
            :.....||.||...:       .|.:||  ::.:..:||                          
Zfish    77 KQAWPDHKRECKCLKHLQPRIPTDSVRL--VARIIFKLL-------------------------- 113

  Fly   346 LSRKPEESENAPEYLRSL----RMVSQLDQAIDEELNYHILCANLLQLYL-KEHTDFYDQFHSLP 405
                 .:||:..|.|.|:    ..::.:.:...|.|.:  ||.. ||:|| :|:.|    ...||
Zfish   114 -----SQSESDQEELYSIAEHQSHLADMSEEKTEGLKH--LCTT-LQVYLAEENCD----LSRLP 166

  Fly   406 ASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSH 470
            :.::...|:.......|:   :::|.:.|  :|||:.|.                          
Zfish   167 SGLDPVSLLARVTCNCFS---ISDGELQD--VGVGLYPS-------------------------- 200

  Fly   471 SDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHP 535
                       :||.||.|:|:....|:|..:...|.:.|...||:...|| |.....|.:||..
Zfish   201 -----------MSLLNHDCQPNCIMMFEGKRLTLRAVRVIRSAEELTISYT-DILAPSKDRRSQH 253

  Fly   536 LKAIYKFECTCAKCTRTD--PDQN 557
            ...:.| |........:|  ||:|
Zfish   254 WDELLK-ESQALLHRHSDVVPDRN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/39 (28%)
SET <447..526 CDD:214614 15/78 (19%)
smyd3NP_001032477.1 zf-MYND 49..87 CDD:280009 11/39 (28%)
SET <201..239 CDD:279228 12/37 (32%)
TPR_12 276..351 CDD:290160 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582759
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.