DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and smyd1b

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001034725.1 Gene:smyd1b / 569027 ZFINID:ZDB-GENE-060522-1 Length:486 Species:Danio rerio


Alignment Length:476 Identity:95/476 - (19%)
Similarity:153/476 - (32%) Gaps:192/476 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA---------------SCFVPLEQLLICQQCAATLM 266
            |:...|| :||.:.|.:....|:|:|:|..               |||...|:|..|.||     
Zfish     5 EVFDSPG-KGRGLRATKEAWAGDVLFAEPPFASVVFDSQASSICHSCFRRQEKLQRCGQC----- 63

  Fly   267 SAPIPCPNCHQRVVYCSRKCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQ 331
                      :...||.:.|:.|....||.||||.:                     .|.:|..:
Zfish    64 ----------RFAQYCDKTCQRAGWEEHKLECAAIK---------------------TYGKPPSE 97

  Fly   332 EM-TSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHI--LCANLLQLYLKE 393
            .: .:|:.:|       |..::..          :||.......|:|..||  :..:.|:.:..:
Zfish    98 NVRLAARILW-------RMDKQGS----------VVSDNQLTTLEDLEDHICDISEDDLKDFKVD 145

  Fly   394 HTDFYDQF--HSLPASIEDWQLIISALILRFAGQLLANGHV-----GDALLGVGMEPKEFVMLQP 451
            ..:|.|.:  :|.|.:::.        :....|.:..||.:     |...:|||:          
Zfish   146 IHNFLDYWPRNSKPHTVDS--------VSHILGVINCNGFMVSDQRGLQAVGVGL---------- 192

  Fly   452 ELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVV----NYAAKD--- 509
                                       .|.|.|.||.|.|:       |:|:    |.:|.|   
Zfish   193 ---------------------------FPNLCLVNHDCWPN-------CTVILNNGNQSAIDTVF 223

  Fly   510 -------------ILEGEEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPD------ 555
                         |..|||:...| :||.| :...|...||..|.|:|||..||....|      
Zfish   224 HSQKRIELRALGKISAGEEVTVAY-VDYLN-VSADRQRLLKQQYFFDCTCKHCTEKIKDDLKMAG 286

  Fly   556 -------------QNYLSFHRYRCEKPN--------------CRQEFLPDAKVQQNNLRWWLRCN 593
                         :....|.|.:.||..              ||:.......|..:...::||  
Zfish   287 AEVDGVKVPEEQVKEVTEFSRQKLEKMEKARIEANYNEVVKICRECVEKQENVLADTHIYYLR-- 349

  Fly   594 AEKPITCTVCHELQHFAWYNE 614
                :.||:...|.:..:::|
Zfish   350 ----VCCTLSEVLSYLQFFDE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 9/39 (23%)
SET <447..526 CDD:214614 19/98 (19%)
smyd1bNP_001034725.1 zf-MYND 47..85 CDD:280009 14/52 (27%)
SET <173..247 CDD:214614 22/117 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582771
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.