DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and AgaP_AGAP009449

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_001230586.1 Gene:AgaP_AGAP009449 / 4578080 VectorBaseID:AGAP009449 Length:257 Species:Anopheles gambiae


Alignment Length:283 Identity:70/283 - (24%)
Similarity:103/283 - (36%) Gaps:65/283 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 CQQCAATLMSAPIPCPNCHQRVVYCSRKC-REAHSAIHKFECAAYRKDILRLLG-ISHLALRLLL 320
            |..|.|......|||..| ..|:|||::| .:|....|::||...| |...:.| ....|||...
Mosquito    19 CDFCHAERPFTLIPCEGC-TWVMYCSQECLSKAFDQYHRYECGVMR-DAYSVCGRFPATALRATA 81

  Fly   321 TYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESEN---------APEYLRSLRMVSQLDQ----A 372
            |.|......|..:.:         :|....|...|         .|:.:.|...|...:|    .
Mosquito    82 TAISIFDGDLVALQN---------HLDALDESQVNGFTMDWRTATPKDVYSTMHVLTTNQERRGL 137

  Fly   373 IDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALL 437
            :|.  .|.||.|.||...:.|.|:......:.|    ....::..||||.|..:..|..:     
Mosquito   138 VDR--TYQILVAILLHKAMVERTELEPTCKASP----KMDKLLFDLILRHAQTIRCNHQL----- 191

  Fly   438 GVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKF--DG- 499
                  ..|...|||        ::|..|.|     ..|...|.:|:.||:|..::|...  || 
Mosquito   192 ------LFFYEGQPE--------EKGFEHKL-----YGAACYPSVSMLNHSCASNVRRLILPDGR 237

  Fly   500 CS--VVNYAAKDILEGEEIFNCY 520
            |:  |:....||.    ::|:.|
Mosquito   238 CAMIVIRPIGKDC----QLFDSY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 14/40 (35%)
SET <447..526 CDD:214614 21/79 (27%)
AgaP_AGAP009449XP_001230586.1 zf-MYND 19..59 CDD:280009 14/40 (35%)
SET <218..257 CDD:279228 13/43 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1278034at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.