DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and Smyd5

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_650955.1 Gene:Smyd5 / 42517 FlyBaseID:FBgn0038869 Length:393 Species:Drosophila melanogaster


Alignment Length:437 Identity:95/437 - (21%)
Similarity:144/437 - (32%) Gaps:166/437 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 EILTDPGPRGRYMVAKEAISKGNVIFSERA------------------SCFVPLEQLLICQQCAA 263
            ||...|| :||.|:|.:..:|..|||.|..                  .|..|||.:|...:..|
  Fly     5 EIRELPG-KGRAMIATKNFAKDEVIFEEEPFVSRQFSWNVAYGYAACDHCMRPLETVLENVRRLA 68

  Fly   264 TLMSAPIP----------------CPNCHQRVVYCSRKC-REAHSAIHKFEC-AAYRKDILRLLG 310
            :.....:|                ||.|  :|.|||..| .||....|:..| .|:..|....:.
  Fly    69 SDPKVEVPLLQHDPTAQWVAQFTQCPRC--KVRYCSEDCLMEAQKRYHRVACMGAFHSDDTHPIN 131

  Fly   311 ISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDE 375
            :.:...:         :.|....|.:..:...:|.|.::..:.|   |:|..|:....|....::
  Fly   132 VLNETWK---------KMHYPPETGSIMLIVRLMALYQQSTKKE---EFLEQLQSFQSLIVNREQ 184

  Fly   376 ELNYHILCAN----LLQLYL--------KEHTDFY--DQFHSLPA------------SIEDWQLI 414
            ::.:.:|..|    :.||||        :|.:.|.  |.|.:|.|            .:..|...
  Fly   185 KIYHKMLGENFEQQMEQLYLAFCNAFTGEEFSIFKTPDAFKTLMAILGTNSQGIATSVLSQWVAK 249

  Fly   415 ISALIL--------------------RFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRH 459
            :|.|.|                    .|||:.|.|            |.....:||.::      
  Fly   250 VSDLPLTDSEKEQLDTVIDGLYAKVGEFAGEFLNN------------EGSGLYLLQSKI------ 296

  Fly   460 LKRGQLHNLSHSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNY--------AAKDILEGEEI 516
                                      ||:|.|      :.||...|        |...|.:||||
  Fly   297 --------------------------NHSCVP------NACSTFPYSNDIVVLKALAPIQQGEEI 329

  Fly   517 FNCYTMDYRNSLKLQRSH-----PLKAIYKFECTCAKC--TRTDPDQ 556
              |  :.|.:...|:||.     .|:..|.|.|.|.||  ..:|||:
  Fly   330 --C--ISYLDECMLERSRHSRHKVLRENYVFICQCPKCRAQASDPDE 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 13/56 (23%)
SET <447..526 CDD:214614 17/86 (20%)
Smyd5NP_650955.1 zf-MYND 87..118 CDD:280009 11/32 (34%)
SET <296..333 CDD:279228 14/78 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452052
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.