DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and adhfe1

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_989277.1 Gene:adhfe1 / 394891 XenbaseID:XB-GENE-966429 Length:463 Species:Xenopus tropicalis


Alignment Length:256 Identity:52/256 - (20%)
Similarity:94/256 - (36%) Gaps:79/256 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 RHLKRGQLHNLSHSD-----PITAINLPY---LSLCNHACEPSIRTKFDGCSVVNYAAKDILEGE 514
            |.|:|......:||.     |:|.....|   :::.|.....:: |:..|..:.|..|:::    
 Frog    13 RQLQRASCKCPAHSHTYSQAPVTGRKTEYAFEMAVSNIRYGENV-TQEIGMDLQNLGARNV---- 72

  Fly   515 EIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQEFLPDA 579
                |...| ||.::|.   |:||:..   :..|        |.:||..|.      |....|..
 Frog    73 ----CVMTD-RNLVELS---PVKAVLN---SLVK--------NNVSFKLYD------RVRVEPTD 112

  Fly   580 KVQQNNLRWWLRCNAEKPITCTVCHELQHFAWYNEFLGLIGSSA-DSSKRQALFKAFDDLDKWLV 643
            |...:.:.:     |:|             ..::.::|:.|.|. |:.|...|:.:....|  .:
 Frog   113 KSFMDAIEF-----AKK-------------GQFDAYVGVGGGSVIDTCKAANLYSSSPGAD--FL 157

  Fly   644 DHHS------------LKRIMAEELVTACFYEIDGGTSLDEFEYEDLARIIRKQLEGIAAQ 692
            |:.:            ||.::|....:....|.   |.:..|:||:|     |...|||::
 Frog   158 DYVNPPIGKGKAVTVPLKPLIAVPTTSGTGSET---TGIAIFDYEEL-----KAKTGIASR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009
SET <447..526 CDD:214614 15/75 (20%)
adhfe1NP_989277.1 HOT 47..460 CDD:341469 44/222 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165168051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.