DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and Ehmt2

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_006256016.2 Gene:Ehmt2 / 361798 RGDID:1302972 Length:1273 Species:Rattus norvegicus


Alignment Length:544 Identity:101/544 - (18%)
Similarity:149/544 - (27%) Gaps:231/544 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 AVFEAENAVEELSLAFANRGIALQEYGYY---------REAYDDCSNA-LECGYPERLRHKVIMR 153
            |.|....|:.|:.|   |....|....|:         ||:|.||... |..|....||:|    
  Rat   888 ASFTGSAAIAEVLL---NAQCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNK---- 945

  Fly   154 QAFCAWKLKKIASLEEHLDYLGQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEI 218
            :...||.|     ..|..|....||           |.:||.|                      
  Rat   946 EGDTAWDL-----TPERSDVWFALQ-----------LNRKLRL---------------------- 972

  Fly   219 LTDPGPRGRYMVAKEAISKGN-VIFSERASCFVPLEQLLICQQCAATLMSAPIPCPN------CH 276
                             ..|| .:.:|:          :||:..|....:.||||.|      |.
  Rat   973 -----------------GVGNRAVRTEK----------IICRDVARGYENVPIPCVNGVDGEPCP 1010

  Fly   277 QRVVYCSRKCREA-----HSAIHKFECAA-------------------YRKDILRLLGISHLALR 317
            :...|.|..|..:     .:..|...|..                   |.||     |      |
  Rat  1011 EDYKYISENCETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKD-----G------R 1064

  Fly   318 LLLTYIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHIL 382
            ||..:.....|.:.|...|...|....|                         :.:...:...  
  Rat  1065 LLQEFNKIEPPLIFECNQACSCWRSCKN-------------------------RVVQSGIKVR-- 1102

  Fly   383 CANLLQLYLKEHTDF-YDQFHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEF 446
                ||||......: .....::|.         ...|..:.|:|     :.||...|..:.   
  Rat  1103 ----LQLYRTAKMGWGVRALQTIPQ---------GTFICEYVGEL-----ISDAEADVREDD--- 1146

  Fly   447 VMLQPELWQKPRHLKRGQLHNLSHSD-PITAINLPYLS----LCNHACEPSI------------- 493
                            ..|.:|.:.| .:..|:..|..    ..||.|:|:|             
  Rat  1147 ----------------SYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLR 1195

  Fly   494 --RTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLKLQRSHPLKAIYKFECTCA--KCTRTDP 554
              |..|       ::::||..|||:    ..||.:     |...:|:.| |.|.|.  ||..:  
  Rat  1196 FPRIAF-------FSSRDIRTGEEL----GFDYGD-----RFWDIKSKY-FTCQCGSEKCKHS-- 1241

  Fly   555 DQNYLSFHRYRCEKPNCRQEFLPD 578
             ...::..:.|..:.:...|.|||
  Rat  1242 -AEAIALEQSRLARLDPHPELLPD 1264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/50 (24%)
SET <447..526 CDD:214614 19/98 (19%)
Ehmt2XP_006256016.2 PHA03247 <5..258 CDD:223021
EHMT_ZBD 473..602 CDD:411018
Ank_2 717..804 CDD:403870
ANK repeat 749..778 CDD:293786
Ank_2 785..878 CDD:403870
ANK repeat 813..845 CDD:293786
ANK repeat 848..878 CDD:293786
Ank_2 852..944 CDD:403870 16/58 (28%)
ANK repeat 880..911 CDD:293786 7/25 (28%)
ANK repeat 913..944 CDD:293786 8/30 (27%)
SET_EHMT2 1011..1249 CDD:380931 55/332 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.