DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and SmydA-4

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_572675.1 Gene:SmydA-4 / 32034 FlyBaseID:FBgn0030257 Length:532 Species:Drosophila melanogaster


Alignment Length:416 Identity:82/416 - (19%)
Similarity:134/416 - (32%) Gaps:151/416 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 GQLQLKESFEQQLEDLKQKLELLKNQPREQETQGKVVDKSLGEILTDPGPRGRYMVAKEAISKGN 239
            |..|.|:..|||  |.:|.    .:...|:|...:|....:         .|||:||...:..|.
  Fly    22 GGQQSKDKQEQQ--DKEQS----PSPTEEKELPYRVEHSDI---------YGRYLVANRQLEAGE 71

  Fly   240 VIFSERASCFVP-LEQLLICQQC--AATLMSAPIPCPNCHQRVVYCSRKC-----REAHSAIHKF 296
            .:..|......| :....:|..|  ..:|.:....||.|...:  |...|     |..|:   :.
  Fly    72 TLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGCAWPL--CGSTCAGLKHRHGHT---ET 131

  Fly   297 ECAAYR-------------------KDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEE 342
            ||..|.                   :|:..|:    :.:|:||     :|.|..|..:.....| 
  Fly   132 ECQLYAERRAVAGELLTERAGPAEVRDLYELV----MIVRILL-----LRQHDPEQFALIARME- 186

  Fly   343 IMNLSRKPEESENA-------PEYLRSLRMVSQLDQAIDEELNYHILCANLLQLYLKEHTDFYDQ 400
                |...|..:||       .:.::.||:..||:....|::  |.:|..|              
  Fly   187 ----SHTEERRQNAVLWRHYEEKVVQRLRVTWQLEDLEAEQV--HEVCGIL-------------- 231

  Fly   401 FHSLPASIEDWQLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQL 465
                  .:..:::          ||   ||.....|.     |..|:                  
  Fly   232 ------DVNCFEI----------GQ---NGAKARTLY-----PSAFL------------------ 254

  Fly   466 HNLSHS-DPITAINLPYLSLCNHACEPSIRTKFDGCSVVNYAAKDILEGEEIFNCYTMDYRNSLK 529
              |:|. .|.||          |..:||   .|:   ::...::.:.|.|.:...|....:.:||
  Fly   255 --LAHDCTPNTA----------HTDDPS---SFE---ILLRTSRRVREREALTLSYAYTLQGTLK 301

  Fly   530 LQR-SHPLKAIYKFECTCAKCTRTDP 554
            .:. .|..|.   |.|.|.:|  :||
  Fly   302 RRAFMHEGKL---FWCCCRRC--SDP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 10/46 (22%)
SET <447..526 CDD:214614 12/79 (15%)
SmydA-4NP_572675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.