DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and Smyd5

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001101340.1 Gene:Smyd5 / 312503 RGDID:1309153 Length:417 Species:Rattus norvegicus


Alignment Length:423 Identity:96/423 - (22%)
Similarity:139/423 - (32%) Gaps:149/423 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RGRYMVAKEAISKGNVIFSER---ASCFV--PLEQLLICQQCAATLMSA---------------P 269
            :|:.:.|.:.|.||..||.||   ||.|:  .|.:...|..|...|..|               |
  Rat    32 KGKGLFATQLIRKGETIFIERPLVASQFLWNALYRYRACDHCLRALEKAEENAQRLTGKPGQVLP 96

  Fly   270 IP------------CPNCHQRVVYCSRKCR-EAHSAIHKFECAAYRKDILRLLGISHLALRLLLT 321
            .|            ||.|  :|.|||.:|| .|....|:..|....:|..|              
  Rat    97 HPELCSVRKDLHQNCPRC--QVTYCSAECRLAAAEQYHQILCPGPSQDDPR-------------- 145

  Fly   322 YIPYIRPHLQEMTSAKGMWEEIMNLSRKPEESENAPEYLRSLRMVSQLDQAIDEELNYHILCANL 386
                     ..:...:..|..:    ..|.|:.:   .:...|||:.:.||.|            
  Rat   146 ---------HPLNKLQEAWRSV----HYPPETAS---IMLMARMVATVKQAKD------------ 182

  Fly   387 LQLYLKEH-TDFYDQFHSLPASIEDWQLIISALILRFAGQLL----------------------- 427
                 |:| ...:..|.|..|: |:.:::...|..:|.|||.                       
  Rat   183 -----KDHWVRLFSHFCSKTAN-EEEEIVHKLLGDKFKGQLELLRRLFTEALYEETLSQWFTPDG 241

  Fly   428 ---------ANG------------HVGDALLGVGMEPKEFVMLQPELWQ--KPRHLKRGQLHNLS 469
                     .||            |..|||   .::|:|...|...:.|  |......|:..|..
  Rat   242 FRSLFALVGTNGQGIGTSSLSQWVHACDAL---ELKPQEREQLDTFIDQLYKDIEAATGEFLNCE 303

  Fly   470 HSDPITAINLPYLSLCNHACEPSIRTKFDGCSVVNY--AAKDILEGEEIFNCYTMDYRNSLKLQR 532
            .|....     ..|.|||:|.|:..|.|...:.:.:  |.:||..||||  |  :.|.:..:.:|
  Rat   304 GSGLFV-----LQSCCNHSCVPNAETSFPENNFLLHVTALEDIEPGEEI--C--ISYLDCCQRER 359

  Fly   533 SHP-----LKAIYKFECTCAKCTRTDPDQNYLS 560
            |..     |:..|.|.|:|.||.....|.|..|
  Rat   360 SRHSRHKILRENYLFVCSCPKCLAEADDPNVTS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 17/67 (25%)
SET <447..526 CDD:214614 23/82 (28%)
Smyd5NP_001101340.1 DUF4599 68..144 CDD:292015 19/77 (25%)
SET <298..351 CDD:214614 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.