DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and Zmynd15

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_001099270.1 Gene:Zmynd15 / 287457 RGDID:1309845 Length:738 Species:Rattus norvegicus


Alignment Length:105 Identity:25/105 - (23%)
Similarity:35/105 - (33%) Gaps:32/105 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 PCPNCHQRVVYCSRKCREA------HSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPH 329
            |||.| ..|:||...|.:|      ....|:|.|.       ||......|..  |..:|:  .:
  Rat   323 PCPQC-SAVLYCGEACLQADWRRCPDDVSHRFWCP-------RLAAFMERAGE--LASLPF--TY 375

  Fly   330 LQEMTS--------------AKGMWEEIMNLSRKPEESEN 355
            ..|:||              .:|.|.::..|...|....|
  Rat   376 TAEVTSETFNKEAFLASRGLTRGYWTQLSMLIPGPGAPRN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 11/32 (34%)
SET <447..526 CDD:214614
Zmynd15NP_001099270.1 zf-MYND 309..355 CDD:280009 11/32 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342698
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.