DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and set-3

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:NP_499143.1 Gene:set-3 / 182356 WormBaseID:WBGene00007403 Length:465 Species:Caenorhabditis elegans


Alignment Length:342 Identity:76/342 - (22%)
Similarity:121/342 - (35%) Gaps:93/342 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 RGRYMVAKEAISKGNVIFSERASCFVPLEQLLICQQCAATLMSAPIPCPNC-----HQRVVYCSR 284
            |||::.|.|.|..|.|                :|.:...|:...|..|..|     :....|| :
 Worm    28 RGRFVEAIEDIPIGTV----------------VCVETGITVNVDPQNCYRCLKITENASFAYC-K 75

  Fly   285 KCREAHSAIHKFECAAYRKDILRLLGISHLALRLLLTYIPYIRPHLQEMTSAKGMWEEIMNL--S 347
            .|.|.:.. .:..|..:.:     |||..||..|:.:| |:               .:|.:|  |
 Worm    76 NCEEFYEP-DEIACGEFDE-----LGIFKLAAHLVFSY-PF---------------ADIASLVQS 118

  Fly   348 RKPEESENAPEYL--RSLRMVSQLD--QAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASI 408
            ..||....||:.|  :.:..:.||.  ..|.|...     |..:|..:|...:      ||... 
 Worm   119 SDPEPPSCAPKALSTQDIEAIFQLTPFPEIGEAFK-----APAIQNAIKRIVE------SLETD- 171

  Fly   409 EDW---QLIISALILRFAGQLLANGHVGDALLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSH 470
            |:|   ..|...:....|.:::|.....:|.....:|..|                 .|..||  
 Worm   172 ENWGRLDQISRTMTFTKALRIMAERSAKNAHTIYSIEQIE-----------------SQEDNL-- 217

  Fly   471 SDPITAINLPYLSLCNHACEPSIRTKFDGCSVVN---YAAKDILEGEEIFNCYTMDYRNSLKLQR 532
              |:.....|..|:.||:|.|:|    .|..|.|   :.::.:...||:.:.|.:.|......||
 Worm   218 --PMATGLFPISSIFNHSCTPNI----SGFFVRNTFIFVSQGVRAREELLDSYGVTYHQHTFEQR 276

  Fly   533 SHPLKAIYKFECTCAKC 549
            ::.|.::..|.|.|..|
 Worm   277 TNFLASVSGFICHCESC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 9/44 (20%)
SET <447..526 CDD:214614 18/81 (22%)
set-3NP_499143.1 SET <220..271 CDD:214614 14/54 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6581
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D463653at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5130
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.