DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and AgaP_AGAP008954

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_319707.4 Gene:AgaP_AGAP008954 / 1279922 VectorBaseID:AGAP008954 Length:453 Species:Anopheles gambiae


Alignment Length:476 Identity:91/476 - (19%)
Similarity:163/476 - (34%) Gaps:177/476 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 KGNVIFSERA-SCFV-PLEQLLICQQCAATLMSAPIPCPNCHQRVVYCSRKCREAHSAIHKFECA 299
            :|:||..|:. :|.: |..:...|.:|...  :..:.|.|| ..|.||.|.|::...:.||.|| 
Mosquito     8 RGDVILQEKPFACVLDPRYRDSRCDRCFKE--TKVMKCSNC-LYVRYCGRSCQKEAWSDHKEEC- 68

  Fly   300 AYRKDILRLL--GISHLALRLLLTYIPYIRPHLQEMTSAKGMWE--------EIMNLSRKPEESE 354
                :.|:.|  |:...:..|::..|  :|..|:...:.||.:.        ::|..........
Mosquito    69 ----EKLKALPPGLVVPSAALMIARI--VRRLLKGGDTHKGYYTSKQYRKFCDLMPHEENIRADS 127

  Fly   355 NAPEYLRSLRMVSQ--LDQAIDEELNYHILCANLLQLYLKEHTDFYDQFHSLPASIEDWQLIISA 417
            ...|:..:|.:|.|  ||:|                              |.|...|        
Mosquito   128 KRMEHFGTLYVVLQRLLDEA------------------------------SRPTKAE-------- 154

  Fly   418 LILRFAGQLLANG-HVGDA---LLGVGMEPKEFVMLQPELWQKPRHLKRGQLHNLSHSDPITAIN 478
             :||..|::..|. ::.||   .:|.||                                     
Mosquito   155 -LLRIYGKMCINTFNILDAEMSTIGTGM------------------------------------- 181

  Fly   479 LPYL--SLCNHACEPSIRTKFDGCSVVNYAAKDILEGE----EIFNCYTMDYRNSLKLQRSHPLK 537
              |:  |:.:|:|.|::...|||.::.....:|..|.|    ::|..| :|..::.:: |...|.
Mosquito   182 --YIGASIIDHSCRPNVVVSFDGETLRMRLLEDYPEQELDFGKLFISY-IDLIDTAEV-RQEQLA 242

  Fly   538 AIYKFECTCAKCTRTDPDQNYLSFHRYRCEKPNCRQ--EFLPDAKVQQNNLRWWLRCNAEKPITC 600
            ..|.|.|.|.:| |.:.:|..:  :...|....|.:  :|....::.|                |
Mosquito   243 ERYYFHCACERC-RDEQEQKRM--NAAACPNTTCHEPLDFSDSEQLNQ----------------C 288

  Fly   601 TVCHELQHFAWYNEFLGLIGSSADSSKRQALFKAFDDLDKWLVDHHSLKRIMAEELVTACFYEID 665
            ..|                |::...|.|:    ||.::..:..||.:..:.:|            
Mosquito   289 PAC----------------GTAVTHSDRE----AFAEISSFTRDHLAQMKSVA------------ 321

  Fly   666 GGTSLDEFEYEDLARI-IRKQ 685
                     |.|::|: :.||
Mosquito   322 ---------YLDVSRLCLEKQ 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009 12/39 (31%)
SET <447..526 CDD:214614 14/84 (17%)
AgaP_AGAP008954XP_319707.4 zf-MYND 31..68 CDD:280009 12/39 (31%)
TPR_12 345..418 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.