DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smyd4-1 and AgaP_AGAP011236

DIOPT Version :9

Sequence 1:NP_610500.2 Gene:Smyd4-1 / 35985 FlyBaseID:FBgn0033427 Length:751 Species:Drosophila melanogaster
Sequence 2:XP_309410.2 Gene:AgaP_AGAP011236 / 1270691 VectorBaseID:AGAP011236 Length:180 Species:Anopheles gambiae


Alignment Length:151 Identity:37/151 - (24%)
Similarity:69/151 - (45%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SQQNELITLNENYKDEFETFKSLASMPADILQIF---QKLALDLLQDLEQPVDRKGCAERSKNL- 69
            ::|:.:..|.:|..|:.:..:.:.....|.|:.|   .:|.|       || |.|   :.:|.| 
Mosquito    23 AKQHRVAILIQNQPDKDKLAELIKRKTDDFLRTFPFRDRLKL-------QP-DTK---DNAKALA 76

  Fly    70 -REEGNLMFKESASGSSKDSVLKACRLYSEAVFEAENAVEELSLAFANRGIALQEYGYYREAYDD 133
             |..||.:|.     ..:...|::.:.|:|::..:|...|..:||:.||.:...:.|..:|..::
Mosquito    77 ARNRGNELFV-----PMQGKYLESLQHYNESIAYSEPGSEARALAYGNRSVVCLKLGLSQECLEN 136

  Fly   134 CSNALECGYPERLRHKVIMRQ 154
            ...|....||.||.:|:..|:
Mosquito   137 IRLARASNYPARLMNKLNKRE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smyd4-1NP_610500.2 zf-MYND 258..298 CDD:280009
SET <447..526 CDD:214614
AgaP_AGAP011236XP_309410.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.