DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or98a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524536.2 Gene:Or98a / 43341 FlyBaseID:FBgn0039551 Length:397 Species:Drosophila melanogaster


Alignment Length:329 Identity:66/329 - (20%)
Similarity:117/329 - (35%) Gaps:99/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 RIRLLIGEQEKREDSRRKVAQRSYYLMVTRCG------MLVFTLGSITTGAFVLRSLWEMWVRRH 163
            :.:.|:.|.:||..:.::..:  .:..|.||.      ..::|..:|:|  |:..:|        
  Fly   107 KAKKLLSEMDKRCTTLKERVE--VHQGVVRCNKAYLIYQFIYTAYTIST--FLSAAL-------- 159

  Fly   164 QEFKFDMPFRML--FHDFAHRMPWFPVFYLYSTWS---GQVTVYAFAGTD-------GFFFGFTL 216
               ...:|:|:.  |.||......|        |.   .:..:..||.|.       ...:|..|
  Fly   160 ---SGKLPWRIYNPFVDFRESRSSF--------WKAALNETALMLFAVTQTLMSDIYPLLYGLIL 213

  Fly   217 YMAFLLQALRYDI-------------QDALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEF 268
            .:...|..||.:.             ||.:|.|:|.:|            |:|....|...|   
  Fly   214 RVHLKLLRLRVESLCTDSGKSDAENEQDLIKCIKDHNL------------IIDYAAAIRPAV--- 263

  Fly   269 SGIMAAPTFVHFVSASLVIATSVIDIL----LYSGYNIIRYV----VYTFTVSSAIFLYCYGGTE 325
                ....||.|:...:.:..|:|::|    :::|...:.|:    |.||.       :|:....
  Fly   264 ----TRTIFVQFLLIGICLGLSMINLLFFADIWTGLATVAYINGLMVQTFP-------FCFVCDL 317

  Fly   326 MSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAPSL-PVFTSVIKFTGSIV 389
            :..:...|..|.:.|.|....|..:..:...:..||:.|.    |.|.|: |:      .|||.:
  Fly   318 LKKDCELLVSAIFHSNWINSSRSYKSSLRYFLKNAQKSIA----FTAGSIFPI------STGSNI 372

  Fly   390 ALAK 393
            .:||
  Fly   373 KVAK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 61/320 (19%)
Or98aNP_524536.2 7tm_6 74..379 CDD:251636 66/329 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465145
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.