DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or94b

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:417 Identity:89/417 - (21%)
Similarity:154/417 - (36%) Gaps:105/417 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FLSRNYPLAKHLFFVTRYSFGLLGLRFGKEQSWLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSP 69
            :|.|.||...|                         |.|.|.::.|.          |....||.
  Fly    36 WLKRIYPFVLH-------------------------LPLTFTYIALM----------WYEAITSS 65

  Fly    70 VDAMDAFCPLACSFTTL---FKLGWMWWRRQEVADLMDRIR------LLIGEQEKREDSRRKVAQ 125
             |..:|...|..|.|.|   .||..:|:||.|.|.|:..::      |...|:.|.....::..:
  Fly    66 -DFEEAGQVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFK 129

  Fly   126 RSYYLMVTRCGMLVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMPWFPVFY 190
            |.:|..:.. .:.|..:|.|:.   ..:..:|:      .|.:.:||.....:          .|
  Fly   130 RIFYWYIWG-SLFVAVMGYISV---FFQEDYEL------PFGYYVPFEWRTRE----------RY 174

  Fly   191 LYSTWSGQVTVYAFA-------GTDGFFFGFTLYMAFLLQALRYD-IQDALKPIRDPSLRESKIC 247
            .|: |...|......       .|.|.:|.|.:...|.|..:|.: :::|.:....|.||.    
  Fly   175 FYA-WGYNVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKARPELRR---- 234

  Fly   248 CQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNII------RYV 306
                  |...|.::.::.:|.. ::.:|    :|.:.:|.:..:|   .:|.|.::      |..
  Fly   235 ------IFQLHTKVRRLTRECE-VLVSP----YVLSQVVFSAFII---CFSAYRLVHMGFKQRPG 285

  Fly   307 VYTFTVSSA------IFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPIT 365
            ::..||...      |||.||.|.|::..:.:|..:.:.:.|..:...||:.:...:...:||:.
  Fly   286 LFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFLKRPVK 350

  Fly   366 VRV-PFFAPSLPVFTSVIKFTGSIVAL 391
            ||. .||...||:|...|....|..||
  Fly   351 VRAGVFFEIGLPIFVKTINNAYSFFAL 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 75/347 (22%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 74/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465444
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.