DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or92a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:389 Identity:90/389 - (23%)
Similarity:163/389 - (41%) Gaps:62/389 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 WLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPVDAMDAFCPLAC---SFTTLFKLGWMWWRRQE 98
            :|...:||..|:|.......|..:...|: .|....::|.....|   ||...||...:...|:.
  Fly    47 YLLRFYLVLGFLNFNAYVVGEIAYFIVHI-MSTTTLLEATAVAPCIGFSFMADFKQFGLTVNRKR 110

  Fly    99 VADLMDRIRLLIGEQEKREDSRRKVAQRSYYLMVTRCG----MLVFTLGSIT-TGAF----VLRS 154
            :..|:|.::.:.....:        |||.|.:...|..    |.:||:..:| |.:|    .::|
  Fly   111 LVRLLDDLKEIFPLDLE--------AQRKYNVSFYRKHMNRVMTLFTILCMTYTSSFSFYPAIKS 167

  Fly   155 LWEMWVRRHQEFKFDMPFRMLF-HDFAHRMPWFPVFYLYSTWS----GQVTVYAFAGTDGFFFG- 213
            ..:.::...:.|:.:..|.:|| :|....:    ..|.:|.|.    ..|...::...|..... 
  Fly   168 TIKYYLMGSEIFERNYGFHILFPYDAETDL----TVYWFSYWGLAHCAYVAGVSYVCVDLLLIAT 228

  Fly   214 ---FTLYMAFLLQALR-YDIQDALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAA 274
               .|::..|:...|. |:..|        ...|..|  :.|.::|..|.....:.:|.:.|.:.
  Fly   229 ITQLTMHFNFIANDLEAYEGGD--------HTDEENI--KYLHNLVVYHARALDLSEEVNNIFSF 283

  Fly   275 PTFVHFVSASLVI--------ATSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEMSTESL 331
            ....:|::|||||        |::|.||:||       ::.::.::.. :|:.||.|.||.:.|.
  Fly   284 LILWNFIAASLVICFAGFQITASNVEDIVLY-------FIFFSASLVQ-VFVVCYYGDEMISSSS 340

  Fly   332 SLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKT 394
            .:|.:|::..|.....:.:|.:..||.|:|:|.::|.|.|.| |...|..||..:....||.:|
  Fly   341 RIGHSAFNQNWLPCSTKYKRILQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALLRT 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 80/348 (23%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 79/345 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465332
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.