DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or85d

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:446 Identity:82/446 - (18%)
Similarity:158/446 - (35%) Gaps:117/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PLAKHLFFVTRY--SFGLLGLRFGKEQSWLHLL--W-LVFNFVNLAHCCQAEFVF-------GWS 63
            ||...|.:...:  |.|::.......|.|..:|  | .:...|||.....:|.::       |.:
  Fly    20 PLHSFLKYANVFYLSIGMMAYDHKYSQKWKEVLLHWTFIAQMVNLNTVLISELIYVFLAIGKGSN 84

  Fly    64 HLRTSPVDAMDAFCPLACSFTTL-----FKLGWMWWRRQEVADLMDRIRLL----IGEQEKREDS 119
            .|..:          :..||...     ||:..:..:|:.:..::.|:..|    :.:||.    
  Fly    85 FLEAT----------MNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEP---- 135

  Fly   120 RRKVAQRSYYLMVTRCGMLVFTLGSITTGAFVLRSLWEMWVRRHQEFKFDMPFRMLFHDFAHRMP 184
                                :.:|...:|           ..|:.:|.|.|...::   :.:.:.
  Fly   136 --------------------YNIGHHLSG-----------YSRYSKFYFGMHMVLI---WTYNLY 166

  Fly   185 WFPVFYLYSTWSG------QVTVYAFAGTDGFFFGFTLYMAFLLQ----------ALRYD-IQDA 232
            |...:.:...|.|      .:..|.:...| :..|::.|..::.|          .|..| :..|
  Fly   167 WAVYYLVCDFWLGMRQFERMLPYYCWVPWD-WSTGYSYYFMYISQNIGGQACLSGQLAADMLMCA 230

  Fly   233 LKP------IRDPSLRESKIC--------CQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSA 283
            |..      ||..:..||.:.        .:.|...|..|..:..:.::.:.|.......:|||:
  Fly   231 LVTLVVMHFIRLSAHIESHVAGIGSFQHDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSS 295

  Fly   284 SLVIA--------TSVIDILLYSGYNIIRYVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSS 340
            |.:|.        .|.||       |::..|::.|.....:|:.......:...|..:|:|.|:.
  Fly   296 SFIICFVGFQMTIGSKID-------NLVMLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYNH 353

  Fly   341 AWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI 395
            .|:..|...|:.:.|||.|||:|..::...|.. ||...:.:::.:....||.:|:
  Fly   354 DWFRADLRYRKMLILIIKRAQQPSRLKATMFLNISLVTVSDLLQLSYKFFALLRTM 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 64/366 (17%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 65/371 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.