DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or85c

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524280.2 Gene:Or85c / 41008 FlyBaseID:FBgn0037591 Length:389 Species:Drosophila melanogaster


Alignment Length:409 Identity:88/409 - (21%)
Similarity:163/409 - (39%) Gaps:59/409 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LFFVTRYSFGL----LGLRFGKEQSWLHLL-WLVFNFVNLAHCCQAEFVF-GWSHLRTSPVDAMD 74
            :||.|  |.|:    :..|..|...|.||| |.  |.:||:.....|.:: |.::.....:||:.
  Fly     8 VFFYT--SVGIEPYTIDSRSKKASLWSHLLFWA--NVINLSVIVFGEILYLGVAYSDGKFIDAVT 68

  Fly    75 AFCPLACSFTTLFKLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVAQRSYYLMVTRCGMLV 139
            ....:......:.|:.::||::.:::||:..:..:....:..|:..|   ...|....:|..:..
  Fly    69 VLSYIGFVIVGMSKMFFIWWKKTDLSDLVKELEHIYPNGKAEEEMYR---LDRYLRSCSRISITY 130

  Fly   140 FTLGSITTGAFVLRSLWEMWVRRHQEFKF-----DMPFRMLFHDFAHRMPWFPVFYLYSTWSGQV 199
            ..|.|:....|.|.|:.:..| ..:..|.     .:|:.|.|       ||    ..:..|:..|
  Fly   131 ALLYSVLIWTFNLFSIMQFLV-YEKLLKIRVVGQTLPYLMYF-------PW----NWHENWTYYV 183

  Fly   200 TVYA--FAG---TDGFFFGFTLYMAFLLQALR---YDIQDALKPIRDPSLRESKICCQRLADIVD 256
            .::.  |||   ..|......|..|...|.:.   |..:...|.:.|....|:.   :.||..|.
  Fly   184 LLFCQNFAGHTSASGQISTDLLLCAVATQVVMHFDYLARVVEKQVLDRDWSENS---RFLAKTVQ 245

  Fly   257 RHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYN---------IIRYVVYTFTV 312
            .|..|.:::...:.|...|..::|:.::.||.        :.|:.         :|:..::.|:.
  Fly   246 YHQRILRLMDVLNDIFGIPLLLNFMVSTFVIC--------FVGFQMTVGVPPDIMIKLFLFLFSS 302

  Fly   313 SSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLP 376
            .|.::|.|:.|..::..|.||..:||...|...|...||.:...|.|.||...::...|.. :..
  Fly   303 LSQVYLICHYGQLIADASSSLSISAYKQNWQNADIRYRRALVFFIARPQRTTYLKATIFMNITRA 367

  Fly   377 VFTSVIKFTGSIVALAKTI 395
            ..|.:::.:....||.:|:
  Fly   368 TMTDLLQVSYKFFALLRTM 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 68/340 (20%)
Or85cNP_524280.2 7tm_6 63..377 CDD:251636 68/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465335
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.