DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or83c

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524244.2 Gene:Or83c / 40744 FlyBaseID:FBgn0037399 Length:397 Species:Drosophila melanogaster


Alignment Length:329 Identity:75/329 - (22%)
Similarity:124/329 - (37%) Gaps:85/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 KREDSRRKV--AQRSYYLMVTRCGMLVFTLGS-----------ITTG---AFVLRSLWEMWVRRH 163
            |.:|.||.|  :|..|....||......||.|           |..|   ||.|..|        
  Fly    91 KHQDMRRLVLYSQSIYDEYETRGDSYHRTLNSNIDRLLGIMKIIRNGYVFAFCLMEL-------- 147

  Fly   164 QEFKFDMPFRMLFHD------FAHRMPWFP--------VFYLYSTWSGQVTVYAFAGTDGF-FFG 213
                  :|..||.:|      ..:.:|..|        |.|:..|.:..|....|...|.| |.|
  Fly   148 ------LPLAMLMYDGTRVTAMQYLIPGLPLENNYCYVVTYMIQTVTMLVQGVGFYSGDLFVFLG 206

  Fly   214 FTLYMAF--LLQALRYDIQDALKP-------IRDPSLRESKICCQR-LADIVDRHNEIEKIVKEF 268
            .|..:.|  :||....::.|||:.       :|..:..:.....|| |.|::..|       :.|
  Fly   207 LTQILTFADMLQVKVKELNDALEQKAEYRALVRVGASIDGAENRQRLLLDVIRWH-------QLF 264

  Fly   269 SGIMAAPTFVHFVSASLVIATSVIDILL---------YSGYNI---IRYVVYTFTVSSAIFLYCY 321
            :....|...:::.    :|||.|:.:.|         .|.:::   |.:||..:::|    :||.
  Fly   265 TDYCRAINALYYE----LIATQVLSMALAMMLSFCINLSSFHMPSAIFFVVSAYSMS----IYCI 321

  Fly   322 GGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAPSLPVFTS--VIKF 384
            .||.:......:.|:..:..||....|.|:....::..:|.|..::: ....||.|.|:  ::|.
  Fly   322 LGTILEFAYDQVYESICNVTWYELSGEQRKLFGFLLRESQYPHNIQI-LGVMSLSVRTALQIVKL 385

  Fly   385 TGSI 388
            ..|:
  Fly   386 IYSV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 74/325 (23%)
Or83cNP_524244.2 7tm_6 69..387 CDD:251636 74/325 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.