DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Orco

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:143 Identity:39/143 - (27%)
Similarity:68/143 - (47%) Gaps:16/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 VDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDILLYSGYNIIRYVVYTFTV------- 312
            |:||..:.::|........|...:|.:::::.:.     :|.|....|....||.|||       
  Fly   342 VERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLT-----LLAYQATKINGVNVYAFTVVGYLGYA 401

  Fly   313 SSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVR-VPFFAPSLP 376
            .:.:|.:|..|..:..||.|:.|||||..||....|.:..|.::..:.|:.:::. ..||..||.
  Fly   402 LAQVFHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLD 466

  Fly   377 VFTSVIKFTGSIV 389
            :|.||:   |::|
  Fly   467 LFASVL---GAVV 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 37/138 (27%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 36/134 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.