DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or74a

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:393 Identity:87/393 - (22%)
Similarity:135/393 - (34%) Gaps:85/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GKEQSWLHLLWLVFNFVNLAHCCQAEFVFGWSHLRTSPVDAMDAFCP---------LACSFTTLF 87
            |:...:|..|.:...|  |..|...|..|.:.......:|.|....|         :.|     |
  Fly    40 GRWTVFLDRLMIFLGF--LVFCEHNEVDFHYLIANRQDMDNMLTGLPTYLILVEMQIRC-----F 97

  Fly    88 KLGWMWWRRQEVADLMDRIRLLIGEQEKREDSRRKVAQRSYYLMVTRCGMLVFTLGSITTGAFVL 152
            :|.   |.:.....|:.|....|...|:.|.......||.  ::.||....|:.|..:  ..|::
  Fly    98 QLA---WHKDRFRALLQRFYAEIYVSEEMEPHLFASIQRQ--MLATRVNSTVYLLALL--NFFLV 155

  Fly   153 RSLWEMWVRRHQEFKFDMPF-RMLFHDFAHRMPWFPVFYLYSTWSGQVTVYAFAGTDGFFFGFTL 216
            .....::.||...:|...|| ....|.|      .|:..| :.|.|.:..       ...||...
  Fly   156 PVTNVIYHRREMLYKQVYPFDNTQLHFF------IPLLVL-NFWVGFIIT-------SMLFGELN 206

  Fly   217 YMAFLL-----------QALRYDIQDALKPIRDPSLRESKICCQRLADIVDRHNEI----EKIVK 266
            .|..|:           |.||...|..||  :..||..:......|..|:.|:..:    :::.|
  Fly   207 VMGELMMHLNARYIQLGQDLRRSAQMLLK--KSSSLNVAIAYRLNLTHILRRNAALRDFGQRVEK 269

  Fly   267 EFSGIMAAPTFVHFV-SASLVIATSVIDILLYSGY-----NIIRYVVYTFTVSSAIFLYCYGGTE 325
            ||:    ...||.|. ||.|:.|      |.:..:     |:...|.:.......:.|...|...
  Fly   270 EFT----LRIFVMFAFSAGLLCA------LFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSIL 324

  Fly   326 MSTESLSLGEAAYSSAW----YTWDR--ETRRRVFLIILRAQRPITVRVPFFAPSLPVF----TS 380
            :.|.. .||...|::.|    :..|.  |..:.:.|:.|..|  :..| |||...|..|    |:
  Fly   325 LKTTD-ELGMMYYTADWEQVIHQSDNVGENVKLMKLVTLAIQ--LNSR-PFFITGLNYFRVSLTA 385

  Fly   381 VIK 383
            |:|
  Fly   386 VLK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 79/357 (22%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 79/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.