DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or45b and Or67b

DIOPT Version :9

Sequence 1:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_524007.2 Gene:Or67b / 39120 FlyBaseID:FBgn0036019 Length:421 Species:Drosophila melanogaster


Alignment Length:432 Identity:92/432 - (21%)
Similarity:164/432 - (37%) Gaps:118/432 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LHLLWLVFNF----VNLAHCCQAEFVFGWSHLRTSPVDAMDAFCPLACSFTTLFKLGWMWWRRQE 98
            |.|||:.::.    ||:|                 |......:|.|......:..|..::   ..
  Fly    18 LGLLWVEYSAYALGVNIA-----------------PRKRSSKYCRLTRILVLIVNLSIIY---SL 62

  Fly    99 VADLMDR---------------IRLLIGEQEKREDSRRKVAQRSYYLMVTRCGMLVFTLG----- 143
            ||.:|:.               .:|.:| ..|....:.||...|..:..|..|.::.:||     
  Fly    63 VAFIMENYMISFETYVEAVLLTFQLSVG-VVKMFHFQNKVESCSQLVFSTETGEVLKSLGLFQLD 126

  Fly   144 ------SITTGAFVLRSLWEMWVRRHQEFKFD---MP---------FRMLFH------------- 177
                  .:::.:.:|.:.| |.:.|...|.|.   ||         |:.:|.             
  Fly   127 LPRKKELLSSVSLILLNNW-MIIDRQVMFFFKIVCMPVLYYCVRPYFQYIFDCYIKDKDTCEMTL 190

  Fly   178 DFAHRMPW-------FP--VFYLYSTWSGQV-TVYAFAGTDGFFFGFTLYMAFLLQALRYDIQDA 232
            .:...:|:       ||  |...:...||.: ..:|..|.:..|...|.|.:.|::.||:.:|::
  Fly   191 TYPAIVPYLQLGNYEFPSYVIRFFLLQSGPLWCFFAVFGFNSLFVVLTRYESGLIKVLRFLVQNS 255

  Fly   233 LKPIRDPSLRESKI--CCQRL-ADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLVIATSVIDI 294
            ...|..|..:..|.  ||.|| |.|...||:||.:.|          ::..|..|  :::.:|.:
  Fly   256 TSDILVPKDQRVKYLQCCVRLFARISSHHNQIENLFK----------YIILVQCS--VSSILICM 308

  Fly   295 LLYSGYNIIR--------YVVYTFTVSSAIFLYCYGGTEMSTESLSLGEAAYSSAWYTWDRETRR 351
            |||....::.        .:||..|::..|.||.....::.::|..|....|:.:||...||.:.
  Fly   309 LLYKISTVLEVGWVWMGMIMVYFVTIALEITLYNVSAQKVESQSELLFHDWYNCSWYNESREFKF 373

  Fly   352 RVFLIILRAQRPITVRVPFFAPSLPVFTSVI-KFTGSIVALA 392
            .:.:::|.::|.       |..|:..|||:. ||...:..|:
  Fly   374 MIKMMLLFSRRT-------FVLSVGGFTSLSHKFLVQVFRLS 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 84/390 (22%)
Or67bNP_524007.2 7tm_6 <197..408 CDD:251636 57/229 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435214
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.